Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate Dsui_2059 Dsui_2059 ABC-type branched-chain amino acid transport system, permease component
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__PS:Dsui_2059 Length = 287 Score = 157 bits (396), Expect = 6e-43 Identities = 100/274 (36%), Positives = 146/274 (53%), Gaps = 35/274 (12%) Query: 197 GLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFA 256 GLL L AF VGAY ALL + +SF L G + +++G PVLRL G Y A Sbjct: 35 GLLSLANAAFMGVGAYVSALLTLHLEWSFGSVLLAGGIAPTLVALIIGAPVLRLSGVYLA 94 Query: 257 IVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEF 316 + TL FGE++RI ++N + TGGP G++GIP + EG Sbjct: 95 MATLAFGEVVRITVLN-LEITGGPEGLNGIPLAT------------EG------------ 129 Query: 317 SPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAA 376 +++ L+LA+ V R+R+ +GRA+EA++ED++A +GIN KL A Sbjct: 130 ---------WHIALILAVAVYGLA-RLRRSKVGRAFEAIKEDEVAARLMGINVDRYKLLA 179 Query: 377 FAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGL 436 F++ A G AG+ A FISP + F + IL + VLGG S IG ++ + ++ L Sbjct: 180 FSLGAFIAGVAGALNAHFTFFISPREYGFENAVDILTMAVLGGTSSLIGPMLGSSILTLL 239 Query: 437 PEAFRELADYRMLAFGMGMVLIMLWRPRGLLAHR 470 PE R L D+R L G +VL++L+ P+GL R Sbjct: 240 PELLRSLQDFRSLVNGAVLVLVVLFLPKGLWESR 273 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 505 Length of database: 287 Length adjustment: 30 Effective length of query: 475 Effective length of database: 257 Effective search space: 122075 Effective search space used: 122075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory