GapMind for catabolism of small carbon sources

 

Aligments for a candidate for AZOBR_RS08245 in Dechlorosoma suillum PS

Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Dsui_2058 Dsui_2058 ABC-type branched-chain amino acid transport systems, ATPase component

Query= uniprot:G8ALJ0
         (294 letters)



>lcl|FitnessBrowser__PS:Dsui_2058 Dsui_2058 ABC-type branched-chain
           amino acid transport systems, ATPase component
          Length = 260

 Score =  197 bits (502), Expect = 2e-55
 Identities = 118/262 (45%), Positives = 162/262 (61%), Gaps = 10/262 (3%)

Query: 11  LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70
           LL++ ++   FGGL  + DVSF    G I  +IGPNGAGKTT+FN ITG  TP+ G++  
Sbjct: 9   LLSIRNVGKHFGGLHVLQDVSFEVPAGSIYGLIGPNGAGKTTVFNLITGLLTPSAGQI-- 66

Query: 71  RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIA 130
              D +   L  +  +RI+ +  +ARTFQNIR+F  M +LEN++V  H+ L    GF I 
Sbjct: 67  ---DFQGQTLIGLEPHRITHQ-GIARTFQNIRIFKEMDLLENVMVGMHDHL-NYGGFGI- 120

Query: 131 GLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVML 190
             L  P+    E++A + A   L  V L   AD  A NL YG QR+LE ARA+ TEP +L
Sbjct: 121 -FLNSPACRAAEKKARERALELLSWVGLDHKADMLADNLSYGDQRKLEFARALATEPKLL 179

Query: 191 CLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKISD 250
            LDEP AG+NP E   L + +  IR+    GV +IEHDM  VM + D + VL++GR I++
Sbjct: 180 LLDEPVAGMNPSEKTILMEEINNIRN-RGYGVFMIEHDMRFVMGLCDRIAVLNFGRIIAE 238

Query: 251 GDPAFVKNDPAVIRAYLGEEED 272
           G P  V+N+P VI AYLG+E++
Sbjct: 239 GTPDEVRNNPDVIEAYLGKEDE 260


Lambda     K      H
   0.319    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 215
Number of extensions: 12
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 294
Length of database: 260
Length adjustment: 25
Effective length of query: 269
Effective length of database: 235
Effective search space:    63215
Effective search space used:    63215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory