Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate Dsui_1110 Dsui_1110 branched-chain amino acid ABC-type transport system, permease component
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__PS:Dsui_1110 Length = 297 Score = 154 bits (388), Expect = 3e-42 Identities = 95/312 (30%), Positives = 163/312 (52%), Gaps = 20/312 (6%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 M F + +I GL+ G MY+ +ALG+ M+Y + NFA G AMV + L V Sbjct: 1 MQFFFEVLIGGLLSGVMYSFVALGFVMIYKASGVFNFAQG------AMVFFAALTFVGFQ 54 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM 120 G P + L++A GA+ +++ + ERI RPL N P + + IG++ ++ LA Sbjct: 55 EMGAPFWLALILAF-GAM---VLLGIATERIVLRPLVNQPHITLFMATIGLTFFVEGLAQ 110 Query: 121 MIWGRSPLPFPQVMPSDPVHI----AGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRA 176 IWG + + +P+ AG L+S + +A + L L + T++GRA Sbjct: 111 GIWGSTVRGLDLGIQDEPIEWIMDKAGILVSSFDLFAAGVAAALVTLLALFFQYTRVGRA 170 Query: 177 MRATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAF 236 +RA A++ + A +G+ + + +A+ +A +AG++W A + QFA+ F LKA Sbjct: 171 LRAVADDHQAALSIGIPLQNIWRIVWAVAGFVALVAGLLWGAR-NGVQFALTFT-ALKAL 228 Query: 237 SAAVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLR 296 +LGG ++ GA++GG+++G E L Y+ G ++G F +++ + L +R Sbjct: 229 PVLILGGFTSVPGAIVGGLIIGSTEKLAEVYL----GGYVGGGIDSWFPYVMALAFLLIR 284 Query: 297 PSGIMGERVADR 308 P G+ GE+ DR Sbjct: 285 PEGLFGEKHIDR 296 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 297 Length adjustment: 27 Effective length of query: 282 Effective length of database: 270 Effective search space: 76140 Effective search space used: 76140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory