Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate Dsui_2060 Dsui_2060 branched-chain amino acid ABC-type transport system, permease component
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__PS:Dsui_2060 Length = 293 Score = 195 bits (495), Expect = 1e-54 Identities = 113/307 (36%), Positives = 182/307 (59%), Gaps = 20/307 (6%) Query: 6 QQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGLP 65 QQ++N L LGS+YAL ALG+T+V+GVL +IN +HG + MVG+ L+++ + AP Sbjct: 4 QQLLNALTLGSVYALFALGFTLVFGVLAVINLSHGAVFMVGSYAALAMVSHLN--AP--- 58 Query: 66 GIVQLVIAIVGAIPVCIVVSLLIERIAYRPLR--NAPRLAPLITAIGVSILLQTLAMMIW 123 L +A++GA+ V + LL++ + +PLR NAP L P+I IGV I+L + A ++ Sbjct: 59 ----LWVAMLGAMVVSGTIGLLVDVLVLKPLRARNAPHLIPMIATIGVGIMLTSAAQGLF 114 Query: 124 GRSPLPFPQ-VMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRATAE 182 G L FP+ VMP+ + + +I ++A+A L M L I+++T++GRA+RA AE Sbjct: 115 GAEVLRFPEDVMPAGEFMVGDVHVRALEIAIVAIAFLLMAVLFTILKRTQLGRALRAIAE 174 Query: 183 NPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVLG 242 +P+ A L+G++ + +T + A L IAGV+ N++ MG K + +LG Sbjct: 175 SPKAAYLLGINVEGLFHITSFVAAALGGIAGVLIGLNFNAITPFMGQPMLHKGIAVIILG 234 Query: 243 GIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGIMG 302 G+G+I GA++GG+ LG E + Y L S D AF +L ++L +RPSG+ G Sbjct: 235 GMGDIRGALIGGLFLGFAEVISKAY--------LSSQMGDAVAFGLLFLILLVRPSGLFG 286 Query: 303 ERVADRA 309 ++ +A Sbjct: 287 RKLERKA 293 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 293 Length adjustment: 27 Effective length of query: 282 Effective length of database: 266 Effective search space: 75012 Effective search space used: 75012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory