GapMind for catabolism of small carbon sources

 

Aligments for a candidate for putA in Dechlorosoma suillum PS

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate Dsui_0105 Dsui_0105 NAD-dependent aldehyde dehydrogenase

Query= BRENDA::Q9RW56
         (523 letters)



>lcl|FitnessBrowser__PS:Dsui_0105 Dsui_0105 NAD-dependent aldehyde
           dehydrogenase
          Length = 476

 Score =  214 bits (546), Expect = 4e-60
 Identities = 157/473 (33%), Positives = 225/473 (47%), Gaps = 23/473 (4%)

Query: 38  KHYPLIIDGQEVDTEGK--IQSINPCDTSEVVGTTAKATIGDAENALQGAWKAFESWKKW 95
           +H    I GQ V  +G   I   NP  T  V+    + T  DA+ A + A  AF +W   
Sbjct: 3   QHSRFYIGGQWVAPDGNAFIDVENPA-TETVIARVPEGTATDADRAARAAAAAFPAWAAL 61

Query: 96  DMDARARILLKAAAILKRRRLEACALMSIEVGKNYAEAD-VEVAEAIDFLEYYARSAMKY 154
               R   L K A  LK R+ E   L++ EVG     A  V+    I      AR A + 
Sbjct: 62  SGAERGAFLQKIADGLKARQDELGRLIASEVGMPVKLATRVQAGNPIFTFAACARIAAE- 120

Query: 155 AGFGSSETTWFEGEENGLMSIPLGVGVSISPWNFPCAIFVGMAAAPIVAGNCVVVKPAED 214
            GF           ++ ++ +P G    I+PWNFP         A + AG  VV+KP+E 
Sbjct: 121 -GFAEERIG-----QSLVLKVPTGPVACITPWNFPLHQIAAKVGAALAAGCTVVLKPSEV 174

Query: 215 AGLIAGFMVDILREAGLPAGVLQFLPGVGKEVGEYLTTHAKTRFITFTGSRAVGLHINEV 274
           A L A  + +++  AGLPAGV   + G G  VGE L  H     ++FTGS A G  +  V
Sbjct: 175 APLNAFLLAEVIEAAGLPAGVFNLVTGYGPVVGEALAAHPALAAVSFTGSTAAGKRVAAV 234

Query: 275 AAKVQPGQKWIKRVIMELGGKDGLIVDETADIENAITAATQGAFGFNGQKCSAMSRLIVV 334
           AA        +KRV +ELGGK   +V   AD+  A+     G F  +GQ CSA++RL+V 
Sbjct: 235 AAAT------VKRVSLELGGKSASVVLPDADLAAAVKGTVAGCFLNSGQACSALTRLLVP 288

Query: 335 DSVYDEVVNGFVERAKALKMGTG-EENANVTAVVNQMSFNKIKGYLELAPSEGKVLLGGE 393
              Y E     V+ A A  +G    E + +  +V+ +   +++  +E A ++G  LL G 
Sbjct: 289 QERYAEAAALAVQAAAAYTLGDPLAEGSRLGPLVSGLQRQRVRAMIEQAVADGAELLCGG 348

Query: 394 ATGEANGKQGYYIQPTIVGDVDRNSRLAQEEIFGPVVAVLRAKDWQDALDIANSTEYGLT 453
           +        GYY++PT+ G V  ++ LA+EE+FGPV+A+L  +D  +A  IAN T+YGL 
Sbjct: 349 SAAPEGLPTGYYVRPTVFGRVRPDAALAREEVFGPVLAILTYRDEAEAEAIANGTDYGLA 408

Query: 454 GGVCSNSRERLEQARAEFEVGNLYFNRKITGAIVG-VQPFGGYNMSGTDSKAG 505
             V S    R          G +     I GA    + PFGG+  SG   + G
Sbjct: 409 AAVWSAEEARALAFARRLRAGQV----DINGAFFNLLAPFGGFKQSGYGRELG 457


Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 561
Number of extensions: 25
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 476
Length adjustment: 34
Effective length of query: 489
Effective length of database: 442
Effective search space:   216138
Effective search space used:   216138
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory