Align 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate Dsui_3250 Dsui_3250 acetylornithine/succinylornithine aminotransferase
Query= BRENDA::Q0K2K2 (423 letters) >FitnessBrowser__PS:Dsui_3250 Length = 390 Score = 194 bits (493), Expect = 4e-54 Identities = 142/401 (35%), Positives = 200/401 (49%), Gaps = 42/401 (10%) Query: 32 ENATLWDVEGRAYTDFAAGIAVLNTGHRHPRVMQAIAAQLERFTHTA--YQIVPYQGYVT 89 E ++D +G+ Y D +GIAV GH HP+++ AIA+Q R HT+ Y+I P Q Sbjct: 19 EGNRIYDTDGKCYLDALSGIAVNTLGHNHPKLVNAIASQAARVLHTSNLYRI-PLQE--E 75 Query: 90 LAERINALVPIQGLNKTALFTTGAEAVENAIKIARAHTGRPGV-----IAFSGAFHGRTL 144 LA+R+ L + + +G EA E AIK+AR + GV I AFHGRTL Sbjct: 76 LADRLAGL---SRMEEVFFCNSGCEANEAAIKLARFFGHQKGVDAPVIIVMEKAFHGRTL 132 Query: 145 LGMALTGKVAPYKIGFGPFPSDIYHAPFPSALHGVSTERALQALEGLFKTDIDPARVAAI 204 ++ TG + GF P S P+ L A+ +++P V A+ Sbjct: 133 ATLSATGN-RKAQAGFEPLVSGFVRVPYND----------LDAIRAA--AELNP-NVVAV 178 Query: 205 IVEPVQGEGGFQAAPADFMRGLRAVCDQHGIVLIADEVQTGFGRTGKMFAMSHHDVEPDL 264 ++E VQGEGG A +F RGLR++CD+ +L+ DEVQ G GRTG F H + PD+ Sbjct: 179 LLEMVQGEGGIHVADPEFQRGLRSLCDEKDWLLMCDEVQCGMGRTGTWFGFQHAGILPDV 238 Query: 265 ITMAKSLAGGMPLSA--VSGRAAIMDAPLPGGLGGTYAGNPLAVAAAHAVIDVIEEEKLC 322 T+AK L G+P+ A +G+AA + PG G T+ GNPLA AAA I IEEEKL Sbjct: 239 ATLAKGLGSGVPIGACMTAGKAAGLFK--PGNHGSTFGGNPLACAAALTTIACIEEEKLR 296 Query: 323 ERSASLGQQLREHLLAQRKHCPAMAEVRGLGSMVAAEFCDPATGQPSAEHAKRVQTRALE 382 E + + G+ +R L + E+RG G M+ E P + + LE Sbjct: 297 ENAVAQGEAIRRGLSEALAGVGGLVEIRGKGLMLGIELDRP---------CGELVAKGLE 347 Query: 383 AGLVLLTCGTYGNVIRFLYPLTIPQAQFDAALAVLTQALAE 423 AGL++ T V+R L LT A + L + E Sbjct: 348 AGLLINV--TAEKVVRLLPALTFSAADTQELVQRLAALIKE 386 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 390 Length adjustment: 31 Effective length of query: 392 Effective length of database: 359 Effective search space: 140728 Effective search space used: 140728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory