Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate Dsui_1833 Dsui_1833 nitrate transport ATP-binding subunits C and D
Query= TCDB::P31134 (377 letters) >FitnessBrowser__PS:Dsui_1833 Length = 266 Score = 152 bits (384), Expect = 1e-41 Identities = 81/203 (39%), Positives = 129/203 (63%), Gaps = 6/203 (2%) Query: 34 AVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPI 93 A+ DV L+I +GE AL+G SGCGKSTLL ++AG +P+ G ++ DG +++ P Sbjct: 23 ALRDVDLSIRQGEFIALIGHSGCGKSTLLNLIAGLTRPTDGALICDGREIAGPGPER--- 79 Query: 94 NMMFQSYALFPHMTVEQNIAFGLKQ---DKLPKAEIASRVNEMLGLVHMQEFAKRKPHQL 150 ++FQ+++L P +T N+ +++ K KA++ R ++ L LV + + PH++ Sbjct: 80 GVVFQNHSLLPWLTCFDNVYLAVERVFAAKEGKAKLKQRTHDALALVGLTHAETKFPHEI 139 Query: 151 SGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQ 210 SGG +QRV +AR+L+ +PK+LL+DEP GALD R ++Q E++ I + T VMVTHD Sbjct: 140 SGGMKQRVGIARALSMQPKVLLMDEPFGALDALTRAKLQDELMKICDATQATVVMVTHDV 199 Query: 211 EEAMTMAGRIAIMNRGKFVQIGE 233 +EA+ ++ RI +M G IGE Sbjct: 200 DEAVLLSDRIVMMTNGPAATIGE 222 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 266 Length adjustment: 27 Effective length of query: 350 Effective length of database: 239 Effective search space: 83650 Effective search space used: 83650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory