Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate Dsui_2943 Dsui_2943 ABC-type spermidine/putrescine transport system, ATPase component
Query= TCDB::P31134 (377 letters) >FitnessBrowser__PS:Dsui_2943 Length = 356 Score = 223 bits (568), Expect = 6e-63 Identities = 136/341 (39%), Positives = 189/341 (55%), Gaps = 14/341 (4%) Query: 20 LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLD 79 LE+ ++ + Y VD + I G I LLG SGCGK+TLLR +AGFE +AG I LD Sbjct: 4 LELADVMQRYGAHTVVDGIGFHIEAGVIACLLGPSGCGKTTLLRCIAGFEDIAAGSIALD 63 Query: 80 GVDLSQ----VPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLG 135 G +S+ + P R I M+FQ YALFPH+TV NIAFGLK E RV ML Sbjct: 64 GELVSRPGFKLAPEQRRIGMVFQDYALFPHLTVADNIAFGLKTKG---GERQQRVAAMLD 120 Query: 136 LVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDI 195 LV + ++ PH+LSGGQ+QRVALAR+LA P+L+LLDEP LD LR+R+ LEV +I Sbjct: 121 LVGLAGQGEKYPHELSGGQQQRVALARALAPAPRLVLLDEPFSNLDVDLRERLSLEVREI 180 Query: 196 LERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNV 255 L++ G T ++VTHDQ EA MA I +M+ G+ Q P +Y P R+ A+F+G Sbjct: 181 LKKAGTTAILVTHDQHEAFAMADEIGVMHEGRIQQWDTPYNLYHQPANRFVADFVGQGVF 240 Query: 256 FEGVLKERQEDGLVLDSPGLVHPLKVDADASVV-DNVPVHVALRPEKIMLCEEPPANGCN 314 G + + L P++ A V V + LRP+ ++ ++ P Sbjct: 241 VPGTVLAGNRVQMELGILESGVPVECSAGCGVCGKGCGVDILLRPDDVVHDDKSPLQAA- 299 Query: 315 FAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKG 355 V H A+ G +Y +RL+SG + + + + H H G Sbjct: 300 -----VEHKAFRGADILYTLRLESGARVLSLVPSHHNHALG 335 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 356 Length adjustment: 30 Effective length of query: 347 Effective length of database: 326 Effective search space: 113122 Effective search space used: 113122 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory