Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate Dsui_1464 Dsui_1464 NAD-dependent aldehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >FitnessBrowser__PS:Dsui_1464 Length = 506 Score = 347 bits (890), Expect = e-100 Identities = 194/484 (40%), Positives = 277/484 (57%), Gaps = 12/484 (2%) Query: 15 QLKIEGRAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGV 74 Q K FI G++ V G+ F+ ++P+ G+ + A D A++ A A + Sbjct: 14 QYKARYDNFIGGKWVAPVKGQYFDVITPITGKPYTQAAQSGAEDIELALDAAHAAADK-- 71 Query: 75 WSQLAPAKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEA 134 W + + +R L++ AD + N+E LA +ET+D GK I ++ + DIP AA + A Sbjct: 72 WGKTSATERSNILLKIADRIEANLEMLAYVETVDNGKAIRETLNADIPLAADHFRYFAGC 131 Query: 135 IDKVYDEVAPTPHDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSE 194 + ++ + + EP+GVVG I+PWNFP+LMA WKL PAL GN VVLKP+E Sbjct: 132 LRSQEGSISEIDENTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALGAGNCVVLKPAE 191 Query: 195 KSPLTAIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMV 254 +P++ + +A+L + +P GVLN++ GYG G ALA + + FTGST + ++ Sbjct: 192 STPISILVLAELIADL-LPPGVLNIVNGYGRDAGMALASSKRIAKIAFTGSTATGR-VIA 249 Query: 255 YAGESNMKRIWLEAGGKSPNIVFADA----PDLQAAAEAAASAIAFNQGEVCTAGSRLLV 310 A +++ LE GGKSPNI FAD D A AFNQGEVCT SR L+ Sbjct: 250 QAAANSLIPATLELGGKSPNIFFADVAAADDDFFDKAIEGLVLFAFNQGEVCTCPSRALI 309 Query: 311 ERSIKDKFLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAG 370 SI D F+ V+ +K K G+PLD + +GA QM+ ++SY+ G ++GA+ L G Sbjct: 310 HESIYDHFMERVLARVKAIKQGSPLDTDSMMGAQASQMQMDKIMSYLAIGKEEGAQCLVG 369 Query: 371 GKRTL---EETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPY 427 G R E G Y++PT+F G N MRI QEEIFGPVL+V F T EA+ IANDTPY Sbjct: 370 GDRARLGGELAEGYYIQPTLFKG-HNKMRIFQEEIFGPVLAVTTFKTEAEALEIANDTPY 428 Query: 428 GLAAGIWTSDISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKY 487 GL AG+W+ D + A++ R ++AG VW N Y A FGG+K+SG GR+ L+ Y Sbjct: 429 GLGAGVWSRDGNTAYRMGRGIKAGRVWTNCYHAYPAHATFGGYKESGIGRETHKMMLDHY 488 Query: 488 TELK 491 + K Sbjct: 489 QQTK 492 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 629 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 506 Length adjustment: 34 Effective length of query: 463 Effective length of database: 472 Effective search space: 218536 Effective search space used: 218536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory