Align Monocarboxylate 2-oxoacid-binding periplasmic protein all3028; Extracellular solute-binding protein; Extracytoplasmic solute receptor protein all3028; TRAP transporter monocarboxylate 2-oxoacid-binding subunit P (characterized)
to candidate Dsui_2650 Dsui_2650 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component
Query= SwissProt::Q8YSQ6 (364 letters) >FitnessBrowser__PS:Dsui_2650 Length = 330 Score = 361 bits (927), Expect = e-104 Identities = 175/323 (54%), Positives = 229/323 (70%), Gaps = 8/323 (2%) Query: 1 MKRREVLNTAAIATATTALVSCTQTNTSSVQAGLPNVRWRMTTSWPKSLGTFIGA-ETVA 59 M+RR+ L A + A A T+ G P VRWR+ +S+PKSL T GA E +A Sbjct: 1 MQRRDFLLGAGASAALGAA-------TARAADGQPVVRWRLASSYPKSLDTLYGASEVLA 53 Query: 60 KRVAEMTNGRFKITPFAAGELVPGLQVLDAVQAGTVECGHTSSYYYIGKSPALAFATSVP 119 RVA +T GRF+I PFAAGE+VPGLQ LDAVQ TVECGHT +Y+GK+ A AF + +P Sbjct: 54 NRVAALTEGRFQIRPFAAGEIVPGLQALDAVQQDTVECGHTLGSFYVGKNRAFAFDSVLP 113 Query: 120 FGLNAQQQYAWLYQGGGLAAIQKIYANFNVINFPAGSTGAQMGGWFKKEIKSVSDLKGLK 179 FGL +QQ AW++ G GL ++++Y ++ VINFP G+TGAQMGGWF+KE++ ++DLKGLK Sbjct: 114 FGLTTRQQTAWMHFGNGLTLLRELYRDYGVINFPGGNTGAQMGGWFRKELQGLADLKGLK 173 Query: 180 MRIPGLGGQVMSRLGVNVQVLPGGEIYLALDRGAIDAAEWVGPYDDEKLGLNKAAQFYYY 239 MRIPGLGG++M+RLG Q +PG ++Y AL++GAIDAAEW GPYDDEKLG K A++YY+ Sbjct: 174 MRIPGLGGEIMARLGAVPQTIPGADVYPALEKGAIDAAEWSGPYDDEKLGFFKVARYYYH 233 Query: 240 PGWWEPGPTLDVLVNLNAWNRLPKEYQEIFKTATVEANLTMLNQYDALNGEALTRLLAGG 299 PGWWEP L LVN W +LPK YQ+ F+ A EA+L +YDA N ALTRLLA G Sbjct: 234 PGWWEPSAQLSFLVNAREWEKLPKAYQQAFEVAAAEAHLLTTAEYDAKNPPALTRLLAQG 293 Query: 300 TKLVPYSQEIMQAAQKISFDIFE 322 KL + ++M+AA + +F +E Sbjct: 294 VKLRRFPDDVMKAAYRAAFAFYE 316 Lambda K H 0.317 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 330 Length adjustment: 29 Effective length of query: 335 Effective length of database: 301 Effective search space: 100835 Effective search space used: 100835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory