Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate Dsui_0630 Dsui_0630 ABC-type branched-chain amino acid transport system, periplasmic component
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__PS:Dsui_0630 Length = 434 Score = 425 bits (1092), Expect = e-123 Identities = 214/358 (59%), Positives = 264/358 (73%), Gaps = 3/358 (0%) Query: 14 AAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGKKIKFEL 73 A AA A+ E VKIGH +P++G QAH GKDNE GA +AIEELNA+G+ IGG K+KFEL Sbjct: 33 APAAAPAAKPEITVKIGHASPLTGPQAHIGKDNEYGATLAIEELNAKGLEIGGAKVKFEL 92 Query: 74 VAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAATNPNL 133 +++DD ADPKQGT AQK DAKV GV+GHLNSGTTIPASK+Y D GIP ++G+ATNP Sbjct: 93 ISDDDQADPKQGTTVAQKFVDAKVNGVIGHLNSGTTIPASKIYFDAGIPQISGSATNPTY 152 Query: 134 TKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKKTATAKG 193 TK G+ T FR++AND G LA +A TL K+VAIIDDRTAYGQG+AD FKK A A G Sbjct: 153 TKQGFATAFRVMANDEQQGKALAQFAAKTLAAKSVAIIDDRTAYGQGLADEFKKAAEAAG 212 Query: 194 MKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGNVKYFGG 253 +KVV ++T DKATDF AILT IK+K PD IFYGGMDPQGGPM +QM++LG+ K+ G Sbjct: 213 LKVVASEYTNDKATDFKAILTKIKSKKPDLIFYGGMDPQGGPMAKQMKELGL-KAKFLTG 271 Query: 254 DGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQFQVYSPYTYD 313 DG CT L AGA G C+ G L KMPGGT +K K+ K+ + Q+Y+PY YD Sbjct: 272 DGGCTPNFITL-AGAAAEGQ-YCSLPGVPLDKMPGGTVFKDKFVGKFKTEIQLYAPYVYD 329 Query: 314 ATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMKNPAITLYVYKDGK 371 AT ++VDAMKRANSV+P Y PE+ K+SF+GVT+ I F+ G++K+ AI+ Y YK GK Sbjct: 330 ATMVLVDAMKRANSVEPAKYLPEIGKTSFQGVTAKIGFDEFGDLKDGAISFYEYKGGK 387 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 434 Length adjustment: 31 Effective length of query: 344 Effective length of database: 403 Effective search space: 138632 Effective search space used: 138632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory