Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate Dsui_2448 Dsui_2448 3-oxoacyl-(acyl-carrier-protein) reductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__PS:Dsui_2448 Length = 246 Score = 111 bits (277), Expect = 2e-29 Identities = 80/268 (29%), Positives = 131/268 (48%), Gaps = 38/268 (14%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTD------- 59 L+ +I VTG + GIG A+ EL GA V + +G + + + Sbjct: 2 LQGQIALVTGASRGIGKAVALELARLGATV----VGTATSDDGAGKISAYLAEAGAKGRG 57 Query: 60 ----ISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKM 115 + ++V + + + FG + LVNNAG+ L + + + ++ + Sbjct: 58 ALLEVRDQAQVDALIAALEKEFGAVSILVNNAGITRDNLAM---------RMKDDEWDAV 108 Query: 116 VNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWS 175 ++ N K VF +S+AV R M+K R+G I+N++S G G+ GQ+ Y A KA ++ TRS + Sbjct: 109 IDTNLKAVFRLSKAVMRGMMKARAGRIINITSVVGHAGNPGQANYCAAKAGVSGMTRSLA 168 Query: 176 KELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRL 235 +ELG I V VAPG ++ + + ++ +EG N IPLGR G Sbjct: 169 RELGSRNITVNCVAPGFIDTDMTKALD-------------DKQKEGLLGN-IPLGRLGSP 214 Query: 236 TEVADFVCYLLSERASYMTGVTTNIAGG 263 ++A V +L S A Y+TG T ++ GG Sbjct: 215 EDIAAAVAFLASPAAGYVTGSTIHVNGG 242 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 246 Length adjustment: 24 Effective length of query: 243 Effective length of database: 222 Effective search space: 53946 Effective search space used: 53946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory