Align Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized)
to candidate Dsui_0627 Dsui_0627 ABC-type branched-chain amino acid transport systems, ATPase component
Query= SwissProt::Q8G847 (513 letters) >FitnessBrowser__PS:Dsui_0627 Length = 267 Score = 119 bits (299), Expect = 1e-31 Identities = 72/236 (30%), Positives = 120/236 (50%), Gaps = 11/236 (4%) Query: 1 MTDKNPIVVMKGITIEFPGVKALDGVDLTLYPGEVHALMGENGAGKSTMIKALTGVYKIN 60 M+++ ++ + F GVKAL GV LT+ GE++ L+G NGAGK+T LTG+Y N Sbjct: 1 MSERPILLEASDVAKHFGGVKALRGVSLTIREGEIYGLIGPNGAGKTTFFNCLTGLYVPN 60 Query: 61 AGSIMVDGKPQQFNGTLDAQNAGIATVYQEVNLCTNLSVGENVMLGHEKR---GPFGIDW 117 G I+ G + GIA +Q + L +++ ENVM+G +R G FG + Sbjct: 61 GGRIVFAGAELDTSAPHKVAARGIARTFQNIRLFAHMTALENVMVGRHQRTRAGVFGAIF 120 Query: 118 KKTHEAAKKYLAQMGLESI--------DPHTPLSSISIAMQQLVAIARAMVINAKVLILD 169 + A++ Q E + H +S Q+ + IARA+ K+L LD Sbjct: 121 RTPGTRAEEAAIQRRAEELLHYVGIADRAHDLAKHLSYGDQRRLEIARALATEPKLLALD 180 Query: 170 EPTSSLDANEVRDLFAIMRKVRDSGVAILFVSHFLDQIYEITDRLTILRNGQFIKE 225 EP + ++A+E +L ++ +R G+ +L + H + + + DR+ +L G+ I E Sbjct: 181 EPAAGMNASETGELRTLIEGIRKDGITVLLIEHDVKLVMGLCDRVAVLDYGEKICE 236 Score = 86.3 bits (212), Expect = 1e-21 Identities = 68/237 (28%), Positives = 116/237 (48%), Gaps = 17/237 (7%) Query: 264 EKPIV----DV-KGLGKKGTINPVDVDIYKGEVVGFAGLLGSGRTELGRLLYGADKPDSG 318 E+PI+ DV K G + V + I +GE+ G G G+G+T L G P+ G Sbjct: 3 ERPILLEASDVAKHFGGVKALRGVSLTIREGEIYGLIGPNGAGKTTFFNCLTGLYVPNGG 62 Query: 319 TYTLNGKKVNISDPYTALKNKIAYSTENRRDEGIIGDLTVRQNILIAL-QATRG-----M 372 G +++ S P+ IA + +N R + +T +N+++ Q TR + Sbjct: 63 RIVFAGAELDTSAPHKVAARGIARTFQNIR---LFAHMTALENVMVGRHQRTRAGVFGAI 119 Query: 373 FKPIPKKEADAIVDKYMKELNVRPADPDRP---VKNLSGGNQQKVLIGRWLATHPELLIL 429 F+ + +A + + +EL DR K+LS G+Q+++ I R LAT P+LL L Sbjct: 120 FRTPGTRAEEAAIQRRAEELLHYVGIADRAHDLAKHLSYGDQRRLEIARALATEPKLLAL 179 Query: 430 DEPTRGIDIGAKAEIQQVVLDLASQGMGVVFISSELEEVVRLSDDIEVLKDRHKIAE 486 DEP G++ E++ ++ + G+ V+ I +++ V+ L D + VL KI E Sbjct: 180 DEPAAGMNASETGELRTLIEGIRKDGITVLLIEHDVKLVMGLCDRVAVLDYGEKICE 236 Lambda K H 0.316 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 513 Length of database: 267 Length adjustment: 30 Effective length of query: 483 Effective length of database: 237 Effective search space: 114471 Effective search space used: 114471 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory