Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate Dsui_2735 Dsui_2735 glycine cleavage system T protein
Query= CharProtDB::CH_000563 (364 letters) >FitnessBrowser__PS:Dsui_2735 Length = 363 Score = 375 bits (963), Expect = e-108 Identities = 202/372 (54%), Positives = 259/372 (69%), Gaps = 17/372 (4%) Query: 1 MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGS 60 M +QT L + H ARMVDF GW MP++YGSQI+EHHAVR D GMFDVSHM VD+ G+ Sbjct: 1 MTKQTVLNKAHRALNARMVDFGGWDMPVNYGSQIEEHHAVRNDCGMFDVSHMCAVDVTGA 60 Query: 61 RTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREK 120 + FL L+AN+V KL GKALYS MLN +GGV+DDLIVYY T+ +R+V+N+ T +K Sbjct: 61 DAKAFLLRLIANNVDKLKVPGKALYSAMLNEAGGVVDDLIVYYLTDTHYRVVINAGTADK 120 Query: 121 DLSWITQHAEPFGIEITV------RDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPF 174 DL+W+ Q + ++++V ++MIAVQGP A+AK + + + A + + PF Sbjct: 121 DLAWMDQLLGQWQLDVSVIPLREGPKAVAMIAVQGPQAKAKVWQVLPEV-KAATKNLAPF 179 Query: 175 FGVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMN 234 FG Q G FIATTGYTGE G+EIALP KA DFW AL+ AGV+PCGLGARDTLRLEAGMN Sbjct: 180 FGTQIGQFFIATTGYTGEDGFEIALPAAKAEDFWNALIAAGVRPCGLGARDTLRLEAGMN 239 Query: 235 LYGQEMDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRN 294 LYGQ+MDET+SPL A + WT+ + ++RDF+G+ AL + + +GL + +KGVLR Sbjct: 240 LYGQDMDETVSPLDAGLAWTVDLK-SERDFVGKSALLANGQKA--QFLGLKLLDKGVLRA 296 Query: 295 ELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEG--IGETAIVQIRNREMPVKVT 352 V +Q EG ITSGTFSPTL SIALAR+P G IG+T V IR + + +V Sbjct: 297 HQKV-----VTSQGEGEITSGTFSPTLEQSIALARLPLGVAIGDTVQVDIRGKLLNAQVV 351 Query: 353 KPVFVRNGKAVA 364 KPVF R+GKAVA Sbjct: 352 KPVFARHGKAVA 363 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 363 Length adjustment: 29 Effective length of query: 335 Effective length of database: 334 Effective search space: 111890 Effective search space used: 111890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Dsui_2735 Dsui_2735 (glycine cleavage system T protein)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.24505.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-128 412.2 0.1 9.7e-128 412.0 0.1 1.0 1 lcl|FitnessBrowser__PS:Dsui_2735 Dsui_2735 glycine cleavage syste Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2735 Dsui_2735 glycine cleavage system T protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.0 0.1 9.7e-128 9.7e-128 2 361 .. 3 357 .. 2 358 .. 0.92 Alignments for each domain: == domain 1 score: 412.0 bits; conditional E-value: 9.7e-128 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaLtk 78 k+t L + h l +++vdf+Gw +Pv+y+s+ieeh+avr++ G+fDvshm v+++G ++ +fL rl+an+vd+L + lcl|FitnessBrowser__PS:Dsui_2735 3 KQTVLNKAHRALNARMVDFGGWDMPVNYGSQIEEHHAVRNDCGMFDVSHMCAVDVTGADAKAFLLRLIANNVDKLKV 79 89*************************************************************************98 PP TIGR00528 79 .GkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehlee...evtldtls...keisllalqG 148 Gka+ys++ln GGvvDDlivy+ ++ ++++v+na+ta+kDl+w+ + l + +v+++ l+ k ++++a+qG lcl|FitnessBrowser__PS:Dsui_2735 80 pGKALYSAMLNEAGGVVDDLIVYYLTDT-HYRVVINAGTADKDLAWMDQLLGQwqlDVSVIPLRegpKAVAMIAVQG 155 8*************************99.******************98764321144444444222667******* PP TIGR00528 149 Pkakt.iledl..ldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGL 222 P+ak+ + + l +++a ++l +ff+ q +++ +ia+tGytGedGfeia++ ka ++w++l++a gv+P+GL lcl|FitnessBrowser__PS:Dsui_2735 156 PQAKAkVWQVLpeVKAATKNLAPFFGTQIGQF-----FIATTGYTGEDGFEIALPAAKAEDFWNALIAA-GVRPCGL 226 *9986354543225667788************.....********************************.******* PP TIGR00528 223 garDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeqkengtekklvGlemlekgiarnelk 299 garDtLrleagm+LyGq++de+++Pl+agl w+v ++ +++df+G+++l +ng + + Gl++l+kg++r + k lcl|FitnessBrowser__PS:Dsui_2735 227 GARDTLRLEAGMNLYGQDMDETVSPLDAGLAWTVDLK-SERDFVGKSAL---LANGQKAQFLGLKLLDKGVLRAHQK 299 *************************************.*********99...57999999***************** PP TIGR00528 300 vlltngekevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361 v++++g +G +tsGt+sPtL+++iala+++ ++ iG++++v++r+kl++++vvk++f r lcl|FitnessBrowser__PS:Dsui_2735 300 VVTSQG---EGEITSGTFSPTLEQSIALARLPLGV-AIGDTVQVDIRGKLLNAQVVKPVFAR 357 ***888...9**********************776.6**********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.08 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory