Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate Dsui_2484 Dsui_2484 hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__PS:Dsui_2484 Length = 267 Score = 189 bits (479), Expect = 6e-53 Identities = 110/257 (42%), Positives = 144/257 (56%), Gaps = 11/257 (4%) Query: 3 LNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGV 62 +++IPAF DNYIW+L R L+VDPGDA PV +A + EAI LTHHH DH GGV Sbjct: 14 ISAIPAFKDNYIWLLQ-RGDRALVVDPGDAAPVQAFLAREGLRLEAILLTHHHADHSGGV 72 Query: 63 KELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFV--LGHEFSVIATPGHTLGHICYFSK 120 L + V GP G + ++ GE LG + V+A PGHT GH+ Y+ + Sbjct: 73 AALAGD--GVRVLGPAAESITGVGEPLRGGERLEFADLGLQLQVLAVPGHTRGHLAYYGQ 130 Query: 121 ----PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFAL 176 P LFCGDTLF GCGRLFEGT +QM SL L+ LP T V CAHEYT +N+ FAL Sbjct: 131 WEGAPVLFCGDTLFGAGCGRLFEGTPAQMAHSLDLLAVLPPQTAVYCAHEYTAANLDFAL 190 Query: 177 SILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEET--LL 234 ++ P + ++ + RKV +R Q T+P+ L E N FLR + ++ + L Sbjct: 191 AVEPGNRALAERVRKVAAMRQAGQATVPLCLAEELATNPFLRCGEAEVRASAERQAGHAL 250 Query: 235 QQPEERFAWLRSKKDRF 251 FA LR K+ F Sbjct: 251 TDEVAVFAALREWKNHF 267 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 267 Length adjustment: 24 Effective length of query: 227 Effective length of database: 243 Effective search space: 55161 Effective search space used: 55161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate Dsui_2484 Dsui_2484 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.24928.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-100 319.6 0.0 7.1e-100 319.4 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_2484 Dsui_2484 hydroxyacylglutathione Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2484 Dsui_2484 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 319.4 0.0 7.1e-100 7.1e-100 1 248 [] 14 267 .] 14 267 .] 0.97 Alignments for each domain: == domain 1 score: 319.4 bits; conditional E-value: 7.1e-100 TIGR03413 1 iiaipalsdNyiwllkdekseavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfpvkvvgpaee 77 i aipa++dNyiwll++ + +a+vvDpg+a+pv+++l+++gl+leaillTHhHaDH ggva+l + +v+v+gpa+e lcl|FitnessBrowser__PS:Dsui_2484 14 ISAIPAFKDNYIWLLQRGD-RALVVDPGDAAPVQAFLAREGLRLEAILLTHHHADHSGGVAALAGD-GVRVLGPAAE 88 678****************.******************************************9764.79******** PP TIGR03413 78 ripgltkevkegdevel..lelevevlevpGHtlgHiayyleee..kvlFcgDtLfsaGCGrlfegtaeqmleslqk 150 +i+g+ ++++ g+++e+ l+l+++vl+vpGHt+gH+ayy + e +vlFcgDtLf+aGCGrlfegt++qm +sl+ lcl|FitnessBrowser__PS:Dsui_2484 89 SITGVGEPLRGGERLEFadLGLQLQVLAVPGHTRGHLAYYGQWEgaPVLFCGDTLFGAGCGRLFEGTPAQMAHSLDL 165 *****************777899*****************9977779****************************** PP TIGR03413 151 laaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeeaevkaal 227 la Lp +t+vycaHEYt++Nl+Falavep n+al+er+++v+a+r++g++t+P laee+atNpFLr+ eaev+a++ lcl|FitnessBrowser__PS:Dsui_2484 166 LAVLPPQTAVYCAHEYTAANLDFALAVEPGNRALAERVRKVAAMRQAGQATVPLCLAEELATNPFLRCGEAEVRASA 242 **************************************************************************999 PP TIGR03413 228 ee....ekaeevevfaelRekkdkf 248 e+ + ++ev+vfa+lRe+k++f lcl|FitnessBrowser__PS:Dsui_2484 243 ERqaghALTDEVAVFAALREWKNHF 267 988888899**************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (267 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory