Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate Dsui_0575 Dsui_0575 electron transfer flavoprotein, alpha subunit
Query= BRENDA::H6LBB1 (418 letters) >FitnessBrowser__PS:Dsui_0575 Length = 360 Score = 221 bits (564), Expect = 2e-62 Identities = 125/335 (37%), Positives = 192/335 (57%), Gaps = 8/335 (2%) Query: 62 EKVAIDKSL--YRGITVYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLM---GTNI 116 +KV +D Y+ + V V+ G++HPV++EL+G+ R+LA +G + ++M G Sbjct: 11 KKVELDPRFVNYKHVWVVVESERGEVHPVSWELLGEGRKLADALGVQLCGVVMCGPGERG 70 Query: 117 TEKADELLKYGVDKVFVYDKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAP 176 E YG DK ++ LK + EPY L D + +P +++GA+ +GR LA Sbjct: 71 AGICGEAFTYGADKCYLMQDEVLKDYRNEPYTKALTDLVNTYQPEILMLGASTLGRDLAG 130 Query: 177 RVAARYRTGLTADCTILEMKENT-DLVQIRPAFGGNIMAQIVTENTRPQFCTVRYKVFTA 235 VA TGL ADCT L ++ T +L RP FGG+++ I+T+ RPQ TVR +V Sbjct: 131 SVATTLGTGLVADCTELVIETETRNLASTRPTFGGSLLCTIMTQRHRPQMATVRPRVMAM 190 Query: 236 PERVNEPWGDVEMMDIEKAKLVSAIEVMEVIKKEKGI--DLSEAETIVAVGRGVKCEKDL 293 PE G++ + + +V+E I + +L A+ IV+ GRG+K ++ Sbjct: 191 PEADGSRSGEIVTVPFSMVETSIVTKVLEFIADDTRDKPNLPFADIIVSGGRGLKKPENF 250 Query: 294 DMIHEFAEKIGATVACTRPGIEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQ 353 ++ + A+ +GA V +RP ++AGW + Q+G SG+TV+PKL IA GISGA+Q GM Sbjct: 251 QLVWDLAKVLGAEVGASRPVVQAGWAELDRQVGQSGKTVRPKLYIAAGISGAIQHRVGMD 310 Query: 354 NSEYIIAINSDPKAPIFNIAHCGMVGDLYEILPEL 388 ++ IIAIN+D APIF+ AH G+VG+ ILP L Sbjct: 311 GADVIIAINTDANAPIFDFAHYGIVGNAMTILPAL 345 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 360 Length adjustment: 30 Effective length of query: 388 Effective length of database: 330 Effective search space: 128040 Effective search space used: 128040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory