Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate Dsui_3149 Dsui_3149 electron transfer flavoprotein, alpha subunit
Query= BRENDA::H6LBB1 (418 letters) >FitnessBrowser__PS:Dsui_3149 Length = 360 Score = 222 bits (565), Expect = 2e-62 Identities = 127/335 (37%), Positives = 194/335 (57%), Gaps = 10/335 (2%) Query: 63 KVAIDKSL--YRGITVYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGT---NIT 117 K+ +D+ L Y+G+ V+V+ G +HPV++EL+G+ R LA +G + ++MG ++ Sbjct: 14 KIKLDEELLAYKGVWVFVESERGHVHPVSWELMGQGRRLADQLGVELCGVVMGAPGPDLE 73 Query: 118 EKADELLKYGVDKVFVYDKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPR 177 + YG D+ + P L + P+ L D + KP +L+GAT +GR LA Sbjct: 74 AQCRAAFAYGADRCYRIASPVLAEYRNVPFTRALTDLVNAHKPEILLLGATTLGRDLAGS 133 Query: 178 VAARYRTGLTADCTILEMK-ENTDLVQIRPAFGGNIMAQIVTENTRPQFCTVRYKVFTAP 236 VA +TGLTADCT L + E+ L+ RP FGG+++ IVT N RPQ TVR++V P Sbjct: 134 VATTLKTGLTADCTELAIDPEDRCLLSTRPTFGGSLLCTIVTLNYRPQMATVRHRVMPMP 193 Query: 237 ERVNEPWG---DVEMMDIEKAKLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGVKCEKDL 293 + E G D E IE + +E + +++K L AE +V+ G+G+ ++ Sbjct: 194 DPQPERTGLIVDFEAGLIETDIVTKVLEFIPDDQRDKP-QLPYAEIVVSGGKGLGKAENF 252 Query: 294 DMIHEFAEKIGATVACTRPGIEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQ 353 + + A+ +G V +R I AGW A Q+G +G+TV+P L IA GISGA+Q GM+ Sbjct: 253 KHVWDLAKVLGGEVGASRAAIHAGWISADRQVGQTGKTVRPALYIAAGISGAIQHRVGME 312 Query: 354 NSEYIIAINSDPKAPIFNIAHCGMVGDLYEILPEL 388 ++ IIAIN+DP APIF+ AH +VGD ++LP L Sbjct: 313 GADCIIAINNDPNAPIFDFAHYAIVGDCNQVLPAL 347 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 360 Length adjustment: 30 Effective length of query: 388 Effective length of database: 330 Effective search space: 128040 Effective search space used: 128040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory