Align L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (characterized, see rationale)
to candidate Dsui_1583 Dsui_1583 (4Fe-4S) cluster-containing protein
Query= uniprot:Q8EGS5 (464 letters) >FitnessBrowser__PS:Dsui_1583 Length = 470 Score = 309 bits (791), Expect = 1e-88 Identities = 173/449 (38%), Positives = 258/449 (57%), Gaps = 20/449 (4%) Query: 34 KALWLLREK----RDRAAGSLPEWEQLRQLGSEIKLHTLTNLAQYLETFEQNCLANGIKV 89 KAL L++ K R AA ++E LR G +I+ L NL +LE FEQ G +V Sbjct: 23 KALKLVQVKFVPGRAAAAAEFGDFETLRDAGRDIRNRALENLDLWLERFEQEATRRGAQV 82 Query: 90 HWAKDGAEHNRIVHEILASHKVKKLVKSKSMLTEECHLNPYLEQRGIEVIDTDLGERIIQ 149 HWA+D AE N I+ I ++ VKK+VKSKSM++EEC LN LE G+ ++TDLGE I+Q Sbjct: 83 HWARDAAEANAIIVGIAQANGVKKVVKSKSMVSEECGLNDALEAAGVTPVETDLGEYILQ 142 Query: 150 L-AKMPPSHIVVPAIHMKKEEVGDLFHDKLGTKAGESDPLYLTRAARAHLREQFLSADAA 208 + PPSHIV P IH ++EV DLFH K G K D L R AR LR FLSAD Sbjct: 143 INDHEPPSHIVAPVIHKTRDEVSDLFHAKHG-KPRTEDIGALCREAREILRPHFLSADMG 201 Query: 209 MTGVNMAIADKGAVVVCTNEGNADMGANLPKLQLHSMGIDKVVPDIDSAAVLLRTLARNA 268 ++G N +A+ G+ V+ TNEGN + +P++ + GI+KVVP ++ +VLLR L R+A Sbjct: 202 ISGANFLVAETGSTVIVTNEGNGRLCTTVPRIHVALTGIEKVVPTLEDLSVLLRLLPRSA 261 Query: 269 TGQPVTTYSAFYRGPQVDG------EMHVIIVDNGRTEMMKDKILAESLKCIRCGGCLNT 322 TGQP+T Y + G G + H++++DNGR+ ++ + L E L+CIRCG C+N Sbjct: 262 TGQPITNYVSMNTGVAGSGDSDGPEQFHIVLLDNGRSRVLGSE-LKEMLRCIRCGACMNH 320 Query: 323 CPVYRRSGGYSYNYTIPGPIGIAVGATH---DNTNSIAWACTLCGSCTYVCPTKVPLDKI 379 CPVY+ GG++Y + PGP+G + ++ ++ + + T CG C+ VCP ++PL ++ Sbjct: 321 CPVYQAVGGHAYGWVYPGPMGSVLTPSYAGMEHAHELPHTATGCGQCSAVCPVRIPLPEL 380 Query: 380 IHHHRRLKAEAGKLPYGKNAYMPLVGKFMASTTLLNCSMGAARTALRILPGS--LLK--P 435 + R ++ EAG P+ + + L G + + L A L+ L G+ L+ P Sbjct: 381 MRKEREMQVEAGLRPWQERLSLKLWGWSASQSWLYGIGTAIAARFLKRLGGADQLIHRLP 440 Query: 436 FSGAWGKYRELPVAPNSSFEAWFKKHRSL 464 G W R+ P +F ++ ++L Sbjct: 441 LGGGWTDGRDFPAPAGKTFRELYRARKNL 469 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 37 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 470 Length adjustment: 33 Effective length of query: 431 Effective length of database: 437 Effective search space: 188347 Effective search space used: 188347 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory