Align The threonine uptake permease, PhtA (Sauer et al., 2005) (required for maximal growth in macrophages and Acanthamoeba castellanii) (characterized)
to candidate Dsui_3451 Dsui_3451 sugar phosphate permease
Query= TCDB::Q5ZY33 (427 letters) >FitnessBrowser__PS:Dsui_3451 Length = 427 Score = 175 bits (443), Expect = 3e-48 Identities = 121/405 (29%), Positives = 183/405 (45%), Gaps = 15/405 (3%) Query: 27 AFYFSDYLARVAPGVMHRYLQMDFGINEAGFGILTASFYVPYILMQIPVGLTVDRLSIRW 86 A Y + R AP + L + F A G L A+++ Y +MQ+P G+ VD L R Sbjct: 24 AAYMLSFFHRFAPAGIAHDLTLAFQTTAASLGALAATYFYVYTIMQVPTGVLVDTLGPRR 83 Query: 87 LLTIMSLVTAFGCCVFGLADGLLTASIGRMLIGFSAAFAFICSLRLATSWFPPTMLGLLS 146 +L + LV A G +FGLAD L A +GR L+G + FI L++ F L Sbjct: 84 ILFLGGLVAAAGSVLFGLADTLNEALVGRTLVGLGVSVTFIAMLKIIAVNFDERRFATLV 143 Query: 147 GLTQALGMLGAAAGEAPVSFLVSNVGWRHSMLIIAFLFIALSGLLYQFVQDKPGEHRNEI 206 G + +G LG+ AP+S L ++ WR + L L + FV+D GE Sbjct: 144 GASMLVGNLGSVLAGAPLSLLAQSISWRGIFVGAGALSALLGVACWFFVKDGGGERPRFD 203 Query: 207 RSVNRISILDSLKIILSNKQTWLNAMYAGFLFGPTAVIGEAIGPAYLQFGRGLGAHAAAF 266 R+V I L +L N+ TW + L G YL L A+ Sbjct: 204 RTV----IFGGLASVLKNRSTWPAVVVNFGLAGSFFSFAGLWATPYLMRVHELTRAQASS 259 Query: 267 ATGLIFIGWGISGPLSGWISDKMGRRKPLMIISAVCGVILSSLFVFIPEMSQTTAYILFF 326 L F G+ + G +SD++G+RKP++I A +L ++ + Y LF Sbjct: 260 HLSLYFAGFALGCFFIGTLSDRLGKRKPVVIAGAFLYCLLWLFWLTNIRLPLAATYCLFG 319 Query: 327 VFGLTNTGVAISYAVSTEIHDRSVVGTSIAFTNMTSIFVGALFQPLVGRIIDMV------ 380 + GLT A+++A + E++ + G S + TNM GAL QPL G +D V Sbjct: 320 LMGLTTASFALTWACAKEVNPPMLSGMSTSVTNMGGFLAGALLQPLAGWAMDQVWDGTLA 379 Query: 381 SGPRAYNVETLLLSDFQAGLKLLPLCSLVALILAFTVKETYCKPI 425 +G R Y +T F+ G+ + + + + F VKET C+ I Sbjct: 380 NGVRVYGPDT-----FRVGMACMAAAACIGFVACFWVKETGCRNI 419 Lambda K H 0.329 0.143 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 427 Length adjustment: 32 Effective length of query: 395 Effective length of database: 395 Effective search space: 156025 Effective search space used: 156025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory