GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Dechlorosoma suillum PS

Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate Dsui_2187 Dsui_2187 acyl-CoA synthetase/AMP-acid ligase

Query= BRENDA::A4YDT1
         (564 letters)



>lcl|FitnessBrowser__PS:Dsui_2187 Dsui_2187 acyl-CoA
           synthetase/AMP-acid ligase
          Length = 565

 Score =  424 bits (1090), Expect = e-123
 Identities = 233/534 (43%), Positives = 328/534 (61%), Gaps = 17/534 (3%)

Query: 35  LRRFNWVRDVFEDIHVKERGSKTALIWRDINTGEEAKLSYHELSLMSNRVLSTLRKHGLK 94
           L  FNW  D F+   V  +G+    +W     G E K+S+ ++S  SN+V + L+  G+K
Sbjct: 33  LTEFNWALDHFD---VMAKGNDKPALWIVEEDGTEHKISFAQMSARSNQVANWLKAQGVK 89

Query: 95  KGDVVYLMTKVHPMHWAVFLAVIKGGFVMVPSATNLTVAEMKYRFSDLKPSAIISDSLRA 154
           +GD + +M       W   L  IK G V++P+ T LT  +++ R    +   +I  +   
Sbjct: 90  RGDRILMMLGNEVPLWETMLGCIKLGAVLIPATTLLTPEDLRDRLDRGQVKHVIIGAAHT 149

Query: 155 SVMEEALGSLKVEKFLIDGKRETWNSLEDE---SSNAEPED-TRGEDVIINYFTSGTTGM 210
               +  G     +  + G+   W + +D    S+   P+  T+  D ++ YFTSGTT  
Sbjct: 150 DKFTDLAGDYT--RICVGGEPAGWKAFKDSHTASAEYTPDAATKVSDPLLLYFTSGTTSK 207

Query: 211 PKRVIHTAVSYPVGSITTASIVGVRESDLHLNLSATGWAKFAWSSFFSPLLVGATVVGIN 270
           PK V+HT  SYPVG ++T   +G++  D+HLN+S+ GWAK AWS FF+P   GA +   N
Sbjct: 208 PKLVLHTHQSYPVGHLSTMYWIGLQPGDIHLNISSPGWAKHAWSCFFAPWNAGACIFLYN 267

Query: 271 YEGKLDTRRYLGEVENLGVTSFCAPPTAWRQFITLDLDQFRFE-RLRSVVSAGEPLNPEV 329
           Y  +   +  L  +E   VT+ CAPPT WR  I  DL  ++   ++R ++ AGEPLNPE+
Sbjct: 268 YS-RFSAKSMLNVLEKYQVTTMCAPPTVWRMMIQEDLAAYKGRLKIRELIGAGEPLNPEI 326

Query: 330 IKIWKDKFNLTIRDFYGQTETTAMVGNFPFLKVKPGSMGKPHPLYDIRLLDDEGKEITKP 389
           I+  ++ +N+TIRD +GQTETTA +GN P   +KPGSMG+P P Y + L+D EG E  + 
Sbjct: 327 IEQLQNAWNITIRDGFGQTETTAEIGNTPGQPLKPGSMGRPLPGYQVVLVDSEGNEAAE- 385

Query: 390 YEVGHITVKLNPRPIGLFLGYS-DEKKNMESFREGYYYTGDKAYFDEEGYFYFVGRGDDV 448
              G I++KLNPRP+GL +GYS D +K  E  R+G Y+TGD A  DE+GY  +VGR DDV
Sbjct: 386 ---GEISLKLNPRPLGLMVGYSGDAEKTAEVMRDGVYHTGDVATKDEDGYITYVGRADDV 442

Query: 449 IKTSDYRVGPFEVESALLEHPAVAEAAVVGVPDTVRWQLVKAYIVLKKGYMPSKELAEEI 508
            K SDYR+ PFE+ES L+EHPAVAEAAVV  PD VR  + KAY++L+ G  PSKELA++I
Sbjct: 443 FKASDYRISPFELESVLIEHPAVAEAAVVPSPDPVRLAVPKAYVILRNGEKPSKELAKDI 502

Query: 509 REKMKTLLSPYKVPRIIEFVDELPKTISGKIRRVELRKREEEKRKKGEVGQNEY 562
              ++  L+PYK  R +EF D LPKTISGKIRRVELR  E ++R   E G+ E+
Sbjct: 503 FAFLRANLAPYKRIRRLEFSD-LPKTISGKIRRVELRANEAKRRNANEKGEWEF 555


Lambda     K      H
   0.318    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 791
Number of extensions: 39
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 564
Length of database: 565
Length adjustment: 36
Effective length of query: 528
Effective length of database: 529
Effective search space:   279312
Effective search space used:   279312
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory