Align TreV, component of Trehalose porter (characterized)
to candidate Dsui_1462 Dsui_1462 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__PS:Dsui_1462 Length = 267 Score = 136 bits (343), Expect = 5e-37 Identities = 77/200 (38%), Positives = 115/200 (57%), Gaps = 7/200 (3%) Query: 17 VINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDKPPEK--- 73 V+ I+ I GEF ++GPSG GKSTLL ++AGI++ D G + G DI + Sbjct: 59 VLERISFNIAAGEFLALMGPSGSGKSTLLNLIAGIDRPDSGTLSVAGQDIAALEEAELAA 118 Query: 74 ---RNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGISEILDKKV 130 NV +FQ Y L P ++ +N+ PL ++ + K E ER E A ++G+++ +D Sbjct: 119 WRAENVGFIFQFYNLMPVLTALENVELPLLLKNLGKAERRERAELALSMVGLADRMDHTP 178 Query: 131 TQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKELKGTFIYVT 190 ++SGGQQQRVA+ARA++ +P+ + DEP +LD L+R+ EL T + VT Sbjct: 179 NELSGGQQQRVAIARALITDPTLIVADEPTGDLDRESAGDILHLLQRLNDELGKTIVMVT 238 Query: 191 HDQKEALSLADRIAILHKGK 210 HDQ+ A S A I L KG+ Sbjct: 239 HDQRAAES-AHAIMHLEKGE 257 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 267 Length adjustment: 26 Effective length of query: 298 Effective length of database: 241 Effective search space: 71818 Effective search space used: 71818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory