Align Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component; EC 1.18.1.3 (characterized)
to candidate Dsui_1825 Dsui_1825 NAD(P)H-dependent nitrite reductase, large subunit
Query= SwissProt::Q84BZ0 (406 letters) >FitnessBrowser__PS:Dsui_1825 Length = 812 Score = 129 bits (324), Expect = 3e-34 Identities = 99/288 (34%), Positives = 140/288 (48%), Gaps = 12/288 (4%) Query: 1 MSADPFVIVGAGHAARRTAEALRARDADA-PIVMIGAERELPYDRPALSKDALLNDDGEQ 59 M+ V+VG G A RT E L D I + GAE Y+R LS L + Sbjct: 1 MNKPKLVLVGNGMAGVRTLEELLKIAPDHYDITVFGAEPHPNYNRILLSP-VLAGEMTVP 59 Query: 60 RAFVRDAAWYDAQRIALRLGTRVDAIEREAQRVRLDDGTTLPYAKLVLATGSRVRTFGGP 119 + D WY I L L +V ++R ++V +DGT Y +L+LATGS F P Sbjct: 60 EIVLNDLQWYADNGIKLHLNKKVTKVDRVRRQVVAEDGTVESYDRLLLATGSN--PFMLP 117 Query: 120 IDA----GVVAHYVRTVADARALRAQLVRGRRVAVLGGGFIGLEVAAAARQLGCNVTVID 175 I GV+A+ R +AD A+ R V+GGG +GLE A + G +VTV+ Sbjct: 118 IPGNDLPGVIAY--RDIADTDAMIEAARTHRHAVVIGGGLLGLEAANGLKLRGMDVTVVH 175 Query: 176 PAARLLQRALPEVVGAYAHRLHDERGVGFQMATLPRAIRAAAGG--GAIVETDRGDVHAD 233 LL+R L EV G + +ERG+ F + A+ A G AI D + AD Sbjct: 176 VGPWLLERQLDEVAGRMLQQSLEERGLKFLLQKNTEALIAGESGRVAAIRFKDGMQIPAD 235 Query: 234 VVVVGIGVLPNVELAQAAGLDVDNGIRVDAGCRTADRAIFAAGEVTMH 281 +VV+ +G+ PN LA+++G+ + GI V +T D I+A GE H Sbjct: 236 LVVMAVGIRPNTALAESSGIHCNRGIVVSDTLQTYDPKIYAVGECVSH 283 Lambda K H 0.322 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 641 Number of extensions: 32 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 812 Length adjustment: 36 Effective length of query: 370 Effective length of database: 776 Effective search space: 287120 Effective search space used: 287120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory