Align Anthranilate 1,2-dioxygenase ferredoxin subunit (characterized)
to candidate Dsui_1826 Dsui_1826 NAD(P)H-dependent nitrite reductase, small subunit
Query= SwissProt::Q84BZ1 (108 letters) >FitnessBrowser__PS:Dsui_1826 Length = 102 Score = 50.4 bits (119), Expect = 6e-12 Identities = 39/104 (37%), Positives = 55/104 (52%), Gaps = 12/104 (11%) Query: 6 LAEWHPLGAIDEFTEDEP--AARVAGQKP---IAVFRI-GDELFAMHDLCSHGHARLSEG 59 +++W L A+ ED P +RV Q P IAVFR GD +FA+HD C H LS+G Sbjct: 1 MSQWKNLCAL----EDIPLLGSRVV-QHPGGDIAVFRTDGDAVFALHDKCPHKGGPLSQG 55 Query: 60 YVEDGCVECPLHQGLIDIRTGAPKCAPITEPVRVYPIRIVDGQV 103 V V CPLH I++ +G AP + +++ DG+V Sbjct: 56 IVHGQRVTCPLHSWNIELASG-EAVAPDQGCTARFQVKVEDGRV 98 Lambda K H 0.321 0.140 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 58 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 108 Length of database: 102 Length adjustment: 11 Effective length of query: 97 Effective length of database: 91 Effective search space: 8827 Effective search space used: 8827 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory