Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate Dsui_2958 Dsui_2958 cobalt transport protein ATP-binding subunit
Query= uniprot:P70970 (276 letters) >FitnessBrowser__PS:Dsui_2958 Length = 279 Score = 169 bits (428), Expect = 6e-47 Identities = 101/252 (40%), Positives = 147/252 (58%), Gaps = 4/252 (1%) Query: 16 SIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLKKLRKKVG 75 S+ GS A+IG GSGK+TL QH NGLL+P G++ + G+ L+ LR KVG Sbjct: 28 SVSRGSRNALIGANGSGKTTLFQHCNGLLRPAAGRVHYAGAPVDYGRAG--LRALRSKVG 85 Query: 76 IVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAREMLQLVGLSEELLDRSPFELSG 135 +VFQ P+ QLF +V +D+SFGP+N G+ + + LQ VG+ ++L + LS Sbjct: 86 LVFQNPDRQLFSASVREDVSFGPLNLGLDEATVAARVEAALQAVGM-DDLAHKPVQNLSF 144 Query: 136 GQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTILVTHSMED 195 GQ +RV IAGVLAM+PE+LVLDEP AGLD ++E++ + LH+RG +T +L TH + Sbjct: 145 GQKKRVCIAGVLAMEPELLVLDEPMAGLDQAMQEELLAVLDGLHRRG-MTILLATHDIHF 203 Query: 196 AAAYADEMIVMHKGTIQASGSPRDLFLKGEEMAGWGLDLPETIKFQRHLEAALGVRFNEP 255 A +AD + +M G AS L E+A GL LP I +R L +R + P Sbjct: 204 AYRWADRIHLMAAGRCCASFDAPALAGHEAELAAIGLRLPSVIGLERQLRQRGLLRGDTP 263 Query: 256 MLTIEDAAAEIR 267 + + A+++ Sbjct: 264 IHSCSALLAQLQ 275 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 279 Length adjustment: 25 Effective length of query: 251 Effective length of database: 254 Effective search space: 63754 Effective search space used: 63754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory