Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate Dsui_0502 Dsui_0502 enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__PS:Dsui_0502 Length = 263 Score = 152 bits (385), Expect = 5e-42 Identities = 93/262 (35%), Positives = 141/262 (53%), Gaps = 8/262 (3%) Query: 5 TIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAG 64 T+ + E + +TLNRP+ LNALN ++E+L A ++AE D + +++ G G+ F AG Sbjct: 3 TVLSHLEDGVLTLTLNRPEALNALNLAMIEDLRAATARAEHDEAVGAVVLRG-GEHFMAG 61 Query: 65 ADITQFNQ---LTPAEAWKFSKKGREIMD----KIEALSKPTIAMINGYALGGGLELALA 117 D+ F+ L PAE ++ + ++ + KP +A ++G A G GL L LA Sbjct: 62 GDLKWFHSQLALPPAERQALFEQTIAAVHATTLQVRRMGKPVVASVSGAAAGFGLSLMLA 121 Query: 118 CDIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGL 177 CD+ +AA+ A L ++G+ P G T L R +G RA E+ + GDR A ++GL Sbjct: 122 CDLAVAADNAYFTLAYCHIGLSPDGGATWFLPRAVGAKRAAEIALLGDRFDAAQAREWGL 181 Query: 178 VNRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFS 237 +NRVVP A LE E+ KLA ++A +LA K ++ + L L E + Sbjct: 182 INRVVPAAELEAESAKLARRLAAGPRQALARTKALLQASSGNSLPEQLFAEQGNFAACSV 241 Query: 238 TEDKKEGVSAFLEKREPTFKGK 259 D EG+ AFLEKR+P F K Sbjct: 242 HPDFAEGLGAFLEKRKPAFGQK 263 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 263 Length adjustment: 25 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory