GapMind for catabolism of small carbon sources

 

Aligments for a candidate for livJ in Dechlorosoma suillum PS

Align ABC transporter substrate-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate Dsui_2061 Dsui_2061 ABC-type branched-chain amino acid transport system, periplasmic component

Query= TCDB::Q8DQI1
         (386 letters)



>lcl|FitnessBrowser__PS:Dsui_2061 Dsui_2061 ABC-type branched-chain
           amino acid transport system, periplasmic component
          Length = 384

 Score =  171 bits (434), Expect = 2e-47
 Identities = 117/342 (34%), Positives = 172/342 (50%), Gaps = 14/342 (4%)

Query: 27  GAVNTAGNSVEEKTIKIGFNFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVD 86
           GA+  AG + +   IKIG     +G  A YG A + G QLA DEINA GG++G +I++V 
Sbjct: 12  GALAAAGLA-QAADIKIGVAAALTGGAAQYGVAIRNGFQLAADEINAKGGVNGNKIQLVV 70

Query: 87  KDNKSETAEAASVTTNLVTQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLT 146
           +D + +  E  +V   L+ Q KV  V GP  S +  AA   A  A   +   S T +G+T
Sbjct: 71  EDEQGKKEEGINVFKKLIFQDKVLMVFGPTLSNSMFAAGPVANGAKTVVFGTSVTANGIT 130

Query: 147 KGQDYLFIGTFQDSFQGKIISNYVSEKLNAKKVVLYTDNASDYAKG---IAKSFRESYKG 203
               Y+F  +  +S    +     ++    K+V +   N   + K    + K   E  K 
Sbjct: 131 DIGPYVFRNSVMESDVLPVTVATATKHYKLKQVAVIYGNDDAFTKSGYDVFKKVLEDQKL 190

Query: 204 EIVADETFVAGDTDFQAALTKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDG 263
            +   ET+V GD DF+A LTK+K  + DA++      EA  I+ QARG+GI  P +GG+G
Sbjct: 191 PVTTTETYVKGDVDFKAQLTKIKASNPDAVICSCLAEEAANIMLQARGLGIKVPFIGGNG 250

Query: 264 FNGEEFVQQATAEKASNIYFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSV 323
           FN  +  +   ++ A    F+    +    +   KAF+ AY  KYN EP+ FAA A+D++
Sbjct: 251 FNSPKLFE--ISKLAGEGTFVGSPWSNTNPAPANKAFVAAYVKKYNAEPNQFAAQAFDAL 308

Query: 324 HLVANAAKGAKNSGEI-------KNNLAKTKDFEGVTGQTSF 358
           H+ A A +  K SG+I       KN L K     G TG   F
Sbjct: 309 HVAAAALQEVKLSGDIAADREALKNALPKA-TINGATGPFKF 349


Lambda     K      H
   0.310    0.126    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 333
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 386
Length of database: 384
Length adjustment: 30
Effective length of query: 356
Effective length of database: 354
Effective search space:   126024
Effective search space used:   126024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory