Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate Dsui_3438 Dsui_3438 beta-hydroxyacid dehydrogenase, 3-hydroxyisobutyrate dehydrogenase
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__PS:Dsui_3438 Length = 299 Score = 170 bits (430), Expect = 4e-47 Identities = 105/285 (36%), Positives = 149/285 (52%), Gaps = 11/285 (3%) Query: 3 DIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVI 62 +I F+GLG MG PMA NLLK GH V+V+ +P+++ L+E GA G S EVVI Sbjct: 2 EIGFIGLGIMGRPMALNLLKGGHGVHVWARRPESMAPLLEAGAVGCSSPAAVAGQVEVVI 61 Query: 63 SMLPAGQHVESLYLGDDGLLARVAGKP----LLIDCSTIAPETARKVAEAAAAKGLTLLD 118 SM+ V + LG DG+ A G + +D STIAP AR +A A+G+ +D Sbjct: 62 SMVADAPDVAQVMLGPDGVAAGAEGAGKHGLVAVDMSTIAPAAARDLAARLQARGVDFVD 121 Query: 119 APVSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLL 178 APVSGG GA AG+LS + GG AE FA+A P +G+N+ H G GAGQVAK CN ++ Sbjct: 122 APVSGGEVGAIAGSLSIMAGGSAEAFAKALPAFLCLGQNVVHVGAAGAGQVAKACNQIVT 181 Query: 179 GILMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGG 238 G+ + AEA + G+DPA + E + + L + Q + G Sbjct: 182 GMGVLAVAEAFNFARQAGVDPAKVREALLGGFAYSRILENHG-------QRMLERNFKPG 234 Query: 239 FQVRLMNKDLGLALANAQAVQASTPLGALARNLFSLHAQADAEHE 283 F+ + KDL + + +A + P A +F+ + E E Sbjct: 235 FKSWMHQKDLNIVMQSAHELGLCLPGAAATAQMFNAMVGSGLEEE 279 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 299 Length adjustment: 27 Effective length of query: 271 Effective length of database: 272 Effective search space: 73712 Effective search space used: 73712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory