Align SDR family oxidoreductase (characterized, see rationale)
to candidate Dsui_2538 Dsui_2538 acetoacetyl-CoA reductase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__PS:Dsui_2538 Length = 246 Score = 121 bits (304), Expect = 1e-32 Identities = 82/253 (32%), Positives = 130/253 (51%), Gaps = 25/253 (9%) Query: 11 KTVLITAAAQGIGRASTELFAREGARVIAT-----DISKTHLEELASIAGVETHLL---D 62 K L+T A G+G A ++ A+EG +V+A D + L E + AG + +L D Sbjct: 3 KVALVTGALGGLGTAISQALAKEGYKVVAAYHPEFDKKEEWLAEQEA-AGFKDFVLVPGD 61 Query: 63 VTDDDAIKALVA----KVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIR 118 V+D ++ KA++A K G +D+L N AG ++ D WD N N ++F+ Sbjct: 62 VSDYESAKAMIAEAEAKAGPIDILVNNAGITRDKFFVKMDKGQWDAVINTNLNSLFNVTH 121 Query: 119 AVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNA 178 V M + G IVNI+S + VKG A + Y A+KA V+G TK++A +F ++G+ NA Sbjct: 122 HVAAKMGERGWGRIVNISSV-NGVKGQAGQTNYSAAKAGVIGFTKALAQEFAAKGVTVNA 180 Query: 179 ICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDES 238 I PG + + K +++ + PM R+ K EE+ A +YL S+ + Sbjct: 181 IAPGYVAT-----------KMVTAIREDILKGIIDSVPMKRLAKPEEIGAAVVYLTSELA 229 Query: 239 NFTTGSIHMIDGG 251 F TG+ I+GG Sbjct: 230 GFVTGATLNINGG 242 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 246 Length adjustment: 24 Effective length of query: 230 Effective length of database: 222 Effective search space: 51060 Effective search space used: 51060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory