Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate Dsui_0676 Dsui_0676 short-chain dehydrogenase of unknown substrate specificity
Query= BRENDA::Q8GR61 (262 letters) >FitnessBrowser__PS:Dsui_0676 Length = 257 Score = 77.0 bits (188), Expect = 4e-19 Identities = 58/182 (31%), Positives = 85/182 (46%), Gaps = 8/182 (4%) Query: 12 VTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTSEEAV 71 +TGA IG A A AE+G + L ++AL A + G A +Y DV+ A+ Sbjct: 8 ITGASSGIGAALARHYAEQGATLGLAARRQQALTDLLADL--PGHHA-AYALDVSDAPAL 64 Query: 72 IGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSD--DFARVLTINVTG-AFHVLKAVS 128 G D + NAG + + + P D F +V+ NV G A + + Sbjct: 65 AAAAADFTARHGAPDIVIANAGV--SVGTLSECPEDLAAFRKVMDTNVYGMAATFVPFIG 122 Query: 129 RQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPG 188 R+V AS+AG++G P AY SK A IA E+ L++AP I+V I+PG Sbjct: 123 PMAAAGGDRRLVGIASVAGIRGLPGAEAYSASKAAAIAYLESLRLEMAPKGIKVVTIAPG 182 Query: 189 YM 190 Y+ Sbjct: 183 YI 184 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 257 Length adjustment: 24 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory