Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate Dsui_2228 Dsui_2228 Zn-dependent alcohol dehydrogenase
Query= CharProtDB::CH_000596 (353 letters) >FitnessBrowser__PS:Dsui_2228 Length = 340 Score = 142 bits (359), Expect = 1e-38 Identities = 101/274 (36%), Positives = 149/274 (54%), Gaps = 15/274 (5%) Query: 7 QNMKAAVMHNT-REIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEK- 64 Q MKAAV+H + + IE +PVP++ +VL+KV+A G+C +DLH G++ V+ Sbjct: 3 QMMKAAVVHEFGKPLVIEEVPVPEVPPGQVLVKVVASGVCHTDLH----AADGDWPVKPS 58 Query: 65 -PFILGHECAGEIAAVGSSVDQFKVGDRVAVE-PGVTCGRCEACKEGRYNLCPDVQFLAT 122 PFI GHE G +AAVG+ V K GDRV V CG CE C G LC D Q + Sbjct: 59 LPFIPGHEGVGYVAAVGAGVTHVKEGDRVGVPWLHTACGHCEHCITGWETLC-DSQQMTG 117 Query: 123 PPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAART-KLQPGSTIAIMGM 181 V+G + +Y+ +V +PD+L + AA + V ++ + + +PG +AI G+ Sbjct: 118 YTVNGGYAEYVLADPGYVGKLPDTLEFAPAAPVLCAGVTVYKGLKVLECKPGDWVAISGI 177 Query: 182 GPVGLMAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEI-KTITNDR 240 G +G MAV AKA G +I D+ +L AK +GA +N D + EI K I Sbjct: 178 GGLGHMAVQYAKAMGF-HVIAVDVADEKLALAKTLGADVTLNAARVDPVAEIQKQIKGAH 236 Query: 241 GVDVAWETAGNPAALQSALASVRRGGKLAIVGLP 274 G+ V TA + +A AL + + G +++VGLP Sbjct: 237 GILV---TAVSRSAFGQALGMLHKRGTMSLVGLP 267 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 340 Length adjustment: 29 Effective length of query: 324 Effective length of database: 311 Effective search space: 100764 Effective search space used: 100764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory