Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate Dsui_3371 Dsui_3371 putative oxidoreductase, aryl-alcohol dehydrogenase like protein
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__PS:Dsui_3371 Length = 350 Score = 100 bits (249), Expect = 5e-26 Identities = 99/320 (30%), Positives = 143/320 (44%), Gaps = 49/320 (15%) Query: 50 IHRAIDLGINIIDTAPAYG-------RGHAEEVVGKAIKGQ-RDNLIIATKVG-----LD 96 + RA+ GIN IDTA Y G E +VG +K Q RD ++IATK ++ Sbjct: 36 LDRAVAAGINFIDTAEMYPVPARAETYGATERIVGSWLKRQARDQVVIATKAAGPARRME 95 Query: 97 WTLTPDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQVHWP---DPL------------ 141 W + + +++ +EDSL+RL TDY+DLYQ+HWP P+ Sbjct: 96 WIRGGPLAF----DLANLRRALEDSLQRLQTDYVDLYQLHWPARNQPMFGQWQFEPEQER 151 Query: 142 --VPIEETATILEALRKEGKIRSIGVSNYSVQQMDEFKKYAE------LAVSQSPYNLFE 193 P+ ET L L +EGKIR +GVSN + EF + A +A +Q+ YNL Sbjct: 152 ESTPLRETLEALAVLVQEGKIRQVGVSNEHPWGVMEFLRLAREHGLPAIASTQNAYNLIN 211 Query: 194 REIDKDILPYAKKNDLV-VLGYGALCRGLLSGRMTADRAFTG--DDLRKTDPKFQKPRFE 250 R D L + V +L Y L G LSG+ AD G +++K Sbjct: 212 RLYDTGGLSEVCFRERVSLLAYSPLAFGHLSGKYLADAKAAGRITAFPGFGQRYEKVNVP 271 Query: 251 HYLAAVEELKKLAKEHYNKSVLALAIRWMLEQGPTLALWGACKPEQIDGIDEVFGWQISD 310 LAA EL A+ + + LALA + G T + GA Q++ E + + Sbjct: 272 PALAAYREL--AARHGLSMTGLALAFCYN-RPGVTSTIIGATSLAQLEENLEAWERRPGA 328 Query: 311 EDLKQIDA---ILAKNIPNP 327 E + I A + + PNP Sbjct: 329 EQWRAIQAEIDAVHQRYPNP 348 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 350 Length adjustment: 29 Effective length of query: 311 Effective length of database: 321 Effective search space: 99831 Effective search space used: 99831 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory