Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate 5209349 Shew_1823 putative AcnD-accessory protein PrpF (RefSeq)
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__PV4:5209349 Length = 389 Score = 210 bits (535), Expect = 4e-59 Identities = 147/388 (37%), Positives = 206/388 (53%), Gaps = 41/388 (10%) Query: 1 MGQTRIPCLLMRGGTSKGAYFLHDDLPA----PGPLRDRVLLAVMGSPD--ARQIDGIGG 54 M Q +IP MRGGTSKG +F DLP PGP RD +LL V+GSPD +Q DG+GG Sbjct: 1 MKQMKIPATYMRGGTSKGVFFALKDLPLNAQQPGPARDALLLRVIGSPDPYGKQTDGMGG 60 Query: 55 ADSLTSKVAIIRASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGLVAA 114 A S TSK I+ SQRDD DVDYLF QV +D+ VD+ NCGN+ A VG FA+ +GLV + Sbjct: 61 ATSSTSKTVILDKSQRDDHDVDYLFGQVAIDKPFVDWSGNCGNLTAAVGAFAITQGLVDS 120 Query: 115 S----GASTPVRIFMENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVAG 170 + V+I+ N + +A VP DG+V+ GD +DGV AA ++V F D A Sbjct: 121 AKIPDNGIAVVKIWQANINKTIIAHVPMVDGEVQELGDFELDGVTFPAAEVLVEFVDPAD 180 Query: 171 ASCGALLPTGNSRDCVE-----GVEVTCIDNGMPVVLLCAEDLGVTGYEPCETLEADSAL 225 G + PTGN D +E + T I+ G+P + L AE LG G E E + D+A Sbjct: 181 GE-GDMFPTGNLVDKLEVPGEPVFDATFINAGIPTIFLKAEQLGYEGTELQEAINGDAAA 239 Query: 226 KTRLEAIR----LQLGPRMNLGDVSQR-NVPKMCLLSAPRNGGT-------------VNT 267 R E IR LQ+G +L + + R + PK+ + AP T ++ Sbjct: 240 LERFETIRAHGALQMGLIQSLDEAAGRQHTPKIAFV-APAKAYTSSSGKQIAAEEIDLHV 298 Query: 268 RSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLASTSGGDRQRLAVEHPSGEFTV--EI 325 R+ + H ++ AV++ TA I G++ A G R+ + HPSG V + Sbjct: 299 RALSMGKLHHAMMGTAAVAIGTAASIPGTLVNQAA--GGQARESVRFGHPSGTLKVGAKA 356 Query: 326 SLEHG--VIKGCGLVRTARLLFDGVVCI 351 S + G ++ + R+AR+L G VC+ Sbjct: 357 SEQEGRWQVEKVSMSRSARVLMQGWVCV 384 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 389 Length adjustment: 30 Effective length of query: 331 Effective length of database: 359 Effective search space: 118829 Effective search space used: 118829 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory