Align Iron-sulfur cluster-binding protein (characterized, see rationale)
to candidate 5210577 Shew_3005 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)
Query= uniprot:Q726S3 (717 letters) >FitnessBrowser__PV4:5210577 Length = 462 Score = 238 bits (607), Expect = 5e-67 Identities = 141/398 (35%), Positives = 213/398 (53%), Gaps = 25/398 (6%) Query: 55 ADAKDHAAKNMDTLYAQFKAEAEKRGVKVHLARTAAEANEIIARIARDNNCKKAIKSKSM 114 ++ K H ++ F+ + G+ VH A+ AE N+I+ I + KK +KSKSM Sbjct: 59 SEMKLHTLTHLGEYLETFEKNCQANGIVVHWAKDGAEHNQIVHNILAKHQVKKLVKSKSM 118 Query: 115 TAEETHLNHRLEEDNVEVIETDLGEWIIQMRHEGPSHMVMPAIHLSRYQVADLF-SEVTK 173 EE HLN LE +EVI+TDLGE IIQ+ + PSH+V+PAIHL + +V DLF ++ Sbjct: 119 LTEECHLNPYLESKGIEVIDTDLGERIIQLAKQPPSHIVVPAIHLKKEEVGDLFHDKLGT 178 Query: 174 QKQEVDIQRLVKVARRELRTHFATADMGISGANFAVAETGTIGLVTNEGNARLVTTLPRV 233 + D L + AR LR F +AD ++G N A+A+ G + + TNEGNA + LP++ Sbjct: 179 EAGASDPLYLTRAARAHLREQFLSADAAMTGVNMAIADKGAVVVCTNEGNADMGANLPKL 238 Query: 234 HVALAGLDKLVPTLHDALRSLKVLPRNATGQAITSYVTWIGGANECEACVDGRKEMHIVF 293 + G+DK+VP L A L+ L RNATGQ IT+Y ++ G DG EMH++ Sbjct: 239 QLHSMGIDKIVPDLDSAAILLRTLARNATGQPITTYSSFYRGPQ------DG-GEMHVII 291 Query: 294 LDNGRRALAEDPLFSQVLRCVRCGACANVCPVYRLVGGHKMGHIYIGAIGLILTYFFHGR 353 +DNGR + +D + ++ L+C+RCG C N CPVYR GG+ + G IG+ + Sbjct: 292 VDNGRTDMLQDKILAESLKCIRCGGCLNTCPVYRRSGGYSYNYTIPGPIGIAVG---AQA 348 Query: 354 DKARNLVQNCINCESCKHICAGGIDLPRLIKEIRARLNEEEG-MPV----ETTLMGKMLK 408 D ++ C C SC ++C + L ++I R RL + G +P L+G + Sbjct: 349 DDTHSIPWACTLCGSCSYVCPTKVPLDKIIHHHR-RLKAKAGKLPYGKRNYMPLVGNFMA 407 Query: 409 NRKLFHTLLRFAKWA--------QKPVTGGTPYIRHLP 438 + + + + A+ A KP +G R LP Sbjct: 408 SETMLNCSMSVARTALRILPGSLLKPFSGAWGKYRELP 445 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 719 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 462 Length adjustment: 36 Effective length of query: 681 Effective length of database: 426 Effective search space: 290106 Effective search space used: 290106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory