Align Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (characterized)
to candidate 5208303 Shew_0815 glucosamine-6-phosphate isomerase (RefSeq)
Query= reanno::PV4:5208303 (268 letters) >FitnessBrowser__PV4:5208303 Length = 268 Score = 518 bits (1335), Expect = e-152 Identities = 268/268 (100%), Positives = 268/268 (100%) Query: 1 MQIVILKDSAEVAEYGANLIINQLKRKPDSVLGLATGSTPVSLYQRLVAANQAGAVSFEG 60 MQIVILKDSAEVAEYGANLIINQLKRKPDSVLGLATGSTPVSLYQRLVAANQAGAVSFEG Sbjct: 1 MQIVILKDSAEVAEYGANLIINQLKRKPDSVLGLATGSTPVSLYQRLVAANQAGAVSFEG 60 Query: 61 VTSFNLDEYLGLEGSHPQSYRYFMDSQLFDAIDINKANTHVPPGDAEDPIAACEAYEAQI 120 VTSFNLDEYLGLEGSHPQSYRYFMDSQLFDAIDINKANTHVPPGDAEDPIAACEAYEAQI Sbjct: 61 VTSFNLDEYLGLEGSHPQSYRYFMDSQLFDAIDINKANTHVPPGDAEDPIAACEAYEAQI 120 Query: 121 QAAGGIDIQLLGIGRNGHIGFNEPSSGLMSRTRVKTLTQATIEDNARFFAEGEYQPHLSI 180 QAAGGIDIQLLGIGRNGHIGFNEPSSGLMSRTRVKTLTQATIEDNARFFAEGEYQPHLSI Sbjct: 121 QAAGGIDIQLLGIGRNGHIGFNEPSSGLMSRTRVKTLTQATIEDNARFFAEGEYQPHLSI 180 Query: 181 TMGIGTILDAKKVLLLATGESKADAIRAAVEGALSAACPASALQLHRDAVLVIDEAAASK 240 TMGIGTILDAKKVLLLATGESKADAIRAAVEGALSAACPASALQLHRDAVLVIDEAAASK Sbjct: 181 TMGIGTILDAKKVLLLATGESKADAIRAAVEGALSAACPASALQLHRDAVLVIDEAAASK 240 Query: 241 LADKEFYRHIEAENQLLQARLAALKAGE 268 LADKEFYRHIEAENQLLQARLAALKAGE Sbjct: 241 LADKEFYRHIEAENQLLQARLAALKAGE 268 Lambda K H 0.316 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 268 Length adjustment: 25 Effective length of query: 243 Effective length of database: 243 Effective search space: 59049 Effective search space used: 59049 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate 5208303 Shew_0815 (glucosamine-6-phosphate isomerase (RefSeq))
to HMM TIGR00502 (nagB: glucosamine-6-phosphate deaminase (EC 3.5.99.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00502.hmm # target sequence database: /tmp/gapView.5794.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00502 [M=259] Accession: TIGR00502 Description: nagB: glucosamine-6-phosphate deaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-96 307.1 0.0 5.1e-96 307.0 0.0 1.0 1 lcl|FitnessBrowser__PV4:5208303 Shew_0815 glucosamine-6-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208303 Shew_0815 glucosamine-6-phosphate isomerase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 307.0 0.0 5.1e-96 5.1e-96 1 252 [. 1 246 [. 1 253 [. 0.97 Alignments for each domain: == domain 1 score: 307.0 bits; conditional E-value: 5.1e-96 TIGR00502 1 mklliletyeelsklaariiaekinefkpdaerpfvlGlatGgtPvglykqlielykagkvsfkkvvtfnldeyvgls 78 m+++il+ e++++ a+ i+++++ kpd vlGlatG+tPv+ly++l+ ++ag vsf+ v+ fnldey+gl+ lcl|FitnessBrowser__PV4:5208303 1 MQIVILKDSAEVAEYGANLIINQLKR-KPD-S---VLGLATGSTPVSLYQRLVAANQAGAVSFEGVTSFNLDEYLGLE 73 89************************.999.5...9****************************************** PP TIGR00502 79 eehPesyhsfmyenffqhidikpeninilnGnaddleaecrryeekikslGkidlfllGiGadGhiafnePgsslesr 156 +hP+sy +fm +++f+ idi++ n +++ G+a+d a+c+ ye +i+ +G+id++llGiG++Ghi+fneP+s l sr lcl|FitnessBrowser__PV4:5208303 74 GSHPQSYRYFMDSQLFDAIDINKANTHVPPGDAEDPIAACEAYEAQIQAAGGIDIQLLGIGRNGHIGFNEPSSGLMSR 151 ****************************************************************************** PP TIGR00502 157 trvktltedtiiansrffegdvnkvPkkaltvGiktildskevlllvsGkekaeavkklvegsvnedvtisalqlhkk 234 trvktlt+ ti n+rff + + P+ ++t+Gi+tild+k+vlll++G++ka+a++++veg+++ ++salqlh++ lcl|FitnessBrowser__PV4:5208303 152 TRVKTLTQATIEDNARFFA-EGEYQPHLSITMGIGTILDAKKVLLLATGESKADAIRAAVEGALSAACPASALQLHRD 228 ******************9.77888***************************************************** PP TIGR00502 235 vivvadeeaaqelkvktl 252 +++v+de+aa++l k + lcl|FitnessBrowser__PV4:5208303 229 AVLVIDEAAASKLADKEF 246 ************987655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (259 nodes) Target sequences: 1 (268 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.27 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory