GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagEcb in Shewanella loihica PV-4

Align N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized)
to candidate 5210198 Shew_2641 PTS system, glucose-like IIB subunint (RefSeq)

Query= reanno::pseudo5_N2C3_1:AO356_17535
         (571 letters)



>lcl|FitnessBrowser__PV4:5210198 Shew_2641 PTS system, glucose-like
           IIB subunint (RefSeq)
          Length = 490

 Score =  281 bits (719), Expect = 4e-80
 Identities = 182/462 (39%), Positives = 257/462 (55%), Gaps = 31/462 (6%)

Query: 10  QRLGRALMLPIAILPIAGLLLRLGDTDL----LDIA-IIHDAGQAIFANLAMIFAIGIAV 64
           QRL +AL+LPIAILP AG+++ L    +     D+A ++   G  +F+ + M+FA+ IA+
Sbjct: 28  QRLSQALLLPIAILPAAGVMIGLATNPIPFISADLATLMWTVGNLVFSMMPMLFAVTIAI 87

Query: 65  GFARDNNGTAGLAGAIGYLVMIATLKVL-------------DASINMGMLAGIISGLLAG 111
           GF RD  G A  +   GY V  ++L  L              A+I+ G+  G++ G    
Sbjct: 88  GFCRDQ-GIAAFSAVFGYGVFFSSLSALAKIYHLPTEMILGQATIDTGIAGGMMVGAFTC 146

Query: 112 ALYNRFKDIKLPEYLAFFGGRRFVPIVTGFSAVGLGVVFGLIWPPIQQGINGFGALLMES 171
            +    + I+LP   +FF GRR  P++    A+ L  +F L+WP +   I       +  
Sbjct: 147 LVVKHSERIRLPAVFSFFEGRRSAPLLMLPMAILLAYLFLLLWPLLSNWIEQISNWAVYQ 206

Query: 172 GSFGAF-VFGVFNRLLIVTGLHHILNNMAWFIFGSFTDPATGAVVTGDLSRYFAGDPKGG 230
               AF V+G+  RLLI  GLHHI N   +   G + +      V G+++RY AGDP+ G
Sbjct: 207 EPASAFAVYGMVERLLIPLGLHHIWNAPFYLEMGQYFNGDEW--VRGEVARYLAGDPQAG 264

Query: 231 QFMTGMFPVMLFGLPAACLAMYRNALPQRRKVMGGILLSMALTSFLTGVTEPIEFAFMFL 290
             + G + + ++GLPAA LA++R A    R  + GI+LS A   +LTGVTEPIEFAFMF+
Sbjct: 265 N-LAGGYLIKMWGLPAAALAIWRCADKHERNRVAGIMLSAATACWLTGVTEPIEFAFMFV 323

Query: 291 APLLFLVHALLTGVSMAVTNLLGIHLGFTFSGGFIDMVLGWGKSTNGWLVVPVGLAYAAI 350
           APLLF++HAL+TG++ AVT  L IH    FS G +D  L  G+S N    + +G   A I
Sbjct: 324 APLLFILHALMTGIAYAVTISLDIHHSVVFSHGLVDFSLLLGQSRNVEWFLILGPLTAVI 383

Query: 351 YYLVFDFCIRRFDLKTPGREEVPAGDKPAIAENQRAAAYIQALGGADNLITIGACTTRLR 410
           YYLVF   I  F+LKTPGR E  +G +  +       + I ALGG DN+  + AC TRLR
Sbjct: 384 YYLVFRGAILAFNLKTPGRMEAGSGQRAGL------ISMITALGGQDNINELTACLTRLR 437

Query: 411 LDMVDRNKASDAQLKALGAMAVVRPGNGGSLQVVVGPMADSI 452
           + +        AQL  LGA  VV  GNG  +Q+V G  A+SI
Sbjct: 438 ISVKHAELVDKAQLNKLGAKGVVLVGNG--VQLVYGTKAESI 477



 Score = 36.2 bits (82), Expect = 3e-06
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 7/85 (8%)

Query: 479 TPAALSSTEAQQ-----WLDALGGQDNVLQLECVATSRLRVRLADDKGLSESRLKGLGCQ 533
           TP  + +   Q+      + ALGGQDN+ +L    T RLR+ +   + + +++L  LG +
Sbjct: 399 TPGRMEAGSGQRAGLISMITALGGQDNINELTACLT-RLRISVKHAELVDKAQLNKLGAK 457

Query: 534 GMSSLEDGVWHLLLGEKAPRLWQAL 558
           G+  + +GV  L+ G KA  + + L
Sbjct: 458 GVVLVGNGV-QLVYGTKAESIRRLL 481


Lambda     K      H
   0.326    0.142    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 661
Number of extensions: 47
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 571
Length of database: 490
Length adjustment: 35
Effective length of query: 536
Effective length of database: 455
Effective search space:   243880
Effective search space used:   243880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory