GapMind for catabolism of small carbon sources

 

Aligments for a candidate for Echvi_1880 in Shewanella loihica PV-4

Align SSS sodium solute transporter (characterized, see rationale)
to candidate 5209833 Shew_2286 SSS family solute/sodium (Na+) symporter (RefSeq)

Query= uniprot:L0FZT5
         (624 letters)



>lcl|FitnessBrowser__PV4:5209833 Shew_2286 SSS family solute/sodium
           (Na+) symporter (RefSeq)
          Length = 519

 Score =  489 bits (1258), Expect = e-142
 Identities = 246/504 (48%), Positives = 348/504 (69%), Gaps = 33/504 (6%)

Query: 7   TLDYVIFIVYALAIVSVGLWVSRTKKGLEKTAQEYFLADKSLTWWAVGASLLAANISAEH 66
           TLD  I +VYAL ++ + LW+SR  K  E+  ++YFLA K+L WWA+GASL+A+NISAE 
Sbjct: 4   TLDIGILLVYALGLLGLALWISRQDKRHERDTKDYFLAGKALPWWAIGASLIASNISAEQ 63

Query: 67  FIGTSGSGFAIGLGISAYEWIAAIALIIVAKYFLPIFLKHGVYTMPQFLSERFNKGVSTA 126
            IG SGSG+AIGL I++YEW+AAI LI+V KY LPIF+K+ +YTMPQ+L +RF+K V T 
Sbjct: 64  IIGMSGSGYAIGLAIASYEWMAAITLILVGKYMLPIFIKNEIYTMPQYLEQRFDKRVKTT 123

Query: 127 FAVFWLLVYVFVNLTSVSYLGALALDKIMGIPLQYGIIGLLIFSGIYSIYGGLEAVAWTD 186
            A+FWL VY+ VNLT+V +LG LA++ + GI   YG++ L +FS  YS+YGGL+AVA+TD
Sbjct: 124 LALFWLSVYILVNLTAVLWLGGLAIETVAGIDWLYGMVFLALFSLAYSLYGGLKAVAYTD 183

Query: 187 VVQVIILVAGGLITTFLALDAVGMGDGIFAGMSNLYNDAKDHFVMIMPQGRVMVPDGLGG 246
           ++QV++L+ GGL+ ++LALD V  G G+ AG   L +   +HF MI+ Q           
Sbjct: 184 IIQVVLLIFGGLLLSYLALDRVADGQGVLAGFDRLSSALPEHFEMILSQ----------- 232

Query: 247 SRDAFQDLPGLAVILGGMWLTNLGYWGFNQYIIQKGLAAKSIEEAKKGLLFAGYLKLLMP 306
           S   +  LPG++V++GG+W+ N+ YWGFNQYIIQ+ LAAKS+ EA+KG+ FA YLKLLMP
Sbjct: 233 SNPHYMSLPGISVLVGGLWIMNISYWGFNQYIIQRALAAKSVAEAQKGIAFAAYLKLLMP 292

Query: 307 IIVVIPGIAAYVLINDYSPEQLAAILNMPVEHIGTIQKSDEAYPWLLRNFIPNGIRGLAF 366
           +IVV+PGIAA +L                      ++  D+AYP ++   +P G++GL F
Sbjct: 293 LIVVLPGIAAVLLYPG-------------------LESPDQAYPSMMA-LMPAGVKGLVF 332

Query: 367 AALAAAIVSSLASMINSTSTIFTMDIYKVYFKPNANNHQLVRTGRIVAVVALAIAMIVA- 425
           AAL AAIVSSLASM NS STIFTMDIY +  +P  +    V  GR+ ++++L IA+++A 
Sbjct: 333 AALVAAIVSSLASMTNSISTIFTMDIYAM-LRPAKSEGHYVLVGRLSSLISLLIALVMAQ 391

Query: 426 PQLASLDQVFQYIQEYTGYIYPGVVVVFGMGLIWRQATASAALWTAIATIPAGIVFKIFY 485
           P L   +Q FQYIQE+TG   PG+VV+F  G+ WR+AT+  AL  A+ +       + ++
Sbjct: 392 PLLGEFEQAFQYIQEFTGVFTPGIVVIFLTGMFWRRATSQGALAAALGSAIFSFGLRFYW 451

Query: 486 PEMPFLLRMGYVFIILCFIASLIS 509
           PE+PF+ R+G VF++   ++ L+S
Sbjct: 452 PELPFMDRIGLVFLLCLALSVLVS 475



 Score = 32.0 bits (71), Expect = 7e-05
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 541 GIICAVLGFALFNSY------EHVGIESIFMIAALFLMLGTILYTNVKMETADPKSFNTD 594
           G + A LG A+F+        E   ++ I ++  L L L ++L + +     +  S    
Sbjct: 432 GALAAALGSAIFSFGLRFYWPELPFMDRIGLVFLLCLAL-SVLVSLMGRSLEEGASVALG 490

Query: 595 PVLFNTTSSFNLGAAGIILIVGLLYYFFW 623
            V F T  +FN+ A G+++I+  LY  +W
Sbjct: 491 GVSFKTGRAFNVSALGVVVILNFLYVTWW 519


Lambda     K      H
   0.327    0.142    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1084
Number of extensions: 56
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 624
Length of database: 519
Length adjustment: 36
Effective length of query: 588
Effective length of database: 483
Effective search space:   284004
Effective search space used:   284004
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory