Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate 5208275 Shew_0787 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding (RefSeq)
Query= curated2:B1L765 (332 letters) >FitnessBrowser__PV4:5208275 Length = 329 Score = 144 bits (362), Expect = 4e-39 Identities = 86/286 (30%), Positives = 150/286 (52%), Gaps = 20/286 (6%) Query: 47 DALVSLLTDPIDAEVFEAAPK--LRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETT 104 + + + + D + EV K +I+A G++N+D++ A + GI V N P E+ Sbjct: 46 EVICAFVNDSLCEEVLVELAKNGTKIIAMRCAGFNNVDLEAAKRLGIRVVNVPAYSPESV 105 Query: 105 ADFAFALLMAAARRVVEADRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVAR 164 A+ AL++ R+V +A + R+ + + ++G++++GRT+G++G G+IG A + Sbjct: 106 AEHTVALMLTLNRKVHKAYQRTRDANFSLEG----LVGFNMHGRTVGVIGTGKIGVATIK 161 Query: 165 RAKGFGMRILYYDSIRREDFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQL 224 GFG +++ YD + ++G+EY+ L++L SD +SLH PLT+E +H++ + Sbjct: 162 ILLGFGCKVVVYDPYPNQAV-LDMGIEYLSLDELYAVSDILSLHCPLTKENHHLLNKASF 220 Query: 225 RRMKRTAILVNTSRGKVVDQKALYKALKEGWIAGAGLDVFEQE----------PIPPDDP 274 +MK +++NTSRG +++ +ALK G I GLDV+E E I DD Sbjct: 221 DKMKPGVMVINTSRGGLLNAFDAMEALKTGQIGSLGLDVYENEKELFFEDKSNQIIQDDV 280 Query: 275 LLKL---ENVVLAPHAASASHETRSRMAEMVAENLIAFKRGEIPPN 317 +L NV+ H A + E +A N+ GE PN Sbjct: 281 FRRLSACHNVIFTGHQAFLTEEALGAIAHTSLTNVRQLLDGEACPN 326 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 329 Length adjustment: 28 Effective length of query: 304 Effective length of database: 301 Effective search space: 91504 Effective search space used: 91504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory