Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate 5208375 Shew_0887 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding (RefSeq)
Query= curated2:Q9YAW4 (335 letters) >FitnessBrowser__PV4:5208375 Length = 317 Score = 177 bits (449), Expect = 3e-49 Identities = 109/285 (38%), Positives = 161/285 (56%), Gaps = 5/285 (1%) Query: 40 LLSKAREADALYTLLTDRIDCDLLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPG 99 LL +A+ A L T T +D D L P L + +A G + +D+ A LGI VTN PG Sbjct: 38 LLDRAQGAQVLLTNKTV-LDADALRALPDLEYIGVLATGTNVVDLNAARELGIKVTNVPG 96 Query: 100 VLTEATAEFTWALILAAARRVVEADHFVRWGEWWRLRTGWHPMMMLGVELRGKTLGILGM 159 +A A+ +A IL +R+ + + V G W + + L L+GKTLG++G Sbjct: 97 YGPDAVAQMVFAHILHHTQRLSDHHNAVVAGAWSQAPDFCFTLAPLQ-SLKGKTLGLVGF 155 Query: 160 GRIGSRVAEIGKAFGMRIIYHSRSRKREIEKELGAEYRSLEDLLRESDILSIHLPLTDET 219 G IG +VA I KAF MR++ ++ S K ++ + G + E L +DI+S+H PLT +T Sbjct: 156 GDIGRQVANIAKAFQMRVLVNTPSIKHDLPE--GVSWCEREALFASADIISLHCPLTPDT 213 Query: 220 RHLIGESELKLMKKTAILVNTGRGAIVDTGALVKALREGWIAAAALDVFEEEPLNPNHPL 279 LI L MK AIL+NT RG +VD AL AL +G IAAA +DV EP ++PL Sbjct: 214 EKLINRERLSAMKPNAILINTARGGLVDEQALANALAQGEIAAAGVDVLSSEPPQADNPL 273 Query: 280 TAFKNVVLAPHAASATRETRLRMAMMAAENLVAFAQGKVPPNLVN 324 + ++ ++PH + AT+E R ++ +A +NL + G+ P NLVN Sbjct: 274 LSAPHISISPHNSWATKEARQQLLTIAVDNLKGYLAGQ-PMNLVN 317 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 317 Length adjustment: 28 Effective length of query: 307 Effective length of database: 289 Effective search space: 88723 Effective search space used: 88723 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory