GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xacD in Shewanella loihica PV-4

Align L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 (characterized)
to candidate 5207771 Shew_0292 dihydroxy-acid dehydratase (RefSeq)

Query= SwissProt::B5ZZ34
         (579 letters)



>lcl|FitnessBrowser__PV4:5207771 Shew_0292 dihydroxy-acid
           dehydratase (RefSeq)
          Length = 616

 Score =  237 bits (605), Expect = 9e-67
 Identities = 187/588 (31%), Positives = 279/588 (47%), Gaps = 70/588 (11%)

Query: 43  GRPVIGILNTWSDMTPCNGHLRELAEKVKAGVWEAGGFPLEVPVFSASEN-TFRPTAMMY 101
           G+P++ I N+++   P + HL+++   V   + EAGG   E    +  +        M+Y
Sbjct: 33  GKPIVAIANSFTQFVPGHVHLKDMGSLVAGAIEEAGGIAKEFNTIAVDDGIAMGHGGMLY 92

Query: 102 ----RNLAALAVEEAIRGQPMDGCVLLVGCDKTTPSLLMGAASCDLPSIVVTGGPMLNGY 157
               R L A +VE  +     D  V +  CDK TP +LM A   ++P + V+GGPM  G 
Sbjct: 93  SLPSRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAG- 151

Query: 158 FRGERVGSGTHLWKFSEMVKAGE--MTQAEFLEAEASMSRSSGTCNTMGTASTMASMAEA 215
            + +       L     MV A +  ++  +  + E S   + G+C+ M TA++M  + EA
Sbjct: 152 -KTKLSDKLIKLDLVDAMVAAADDRVSDEDSEKIERSACPTCGSCSGMFTANSMNCLTEA 210

Query: 216 LGMALSGNAAIPGVDSRRKVMAQLTGRRIVQMV----KDDLK---PSEIMTKQAFENAIR 268
           LG++L GN ++    S R+ +    GRR++ +     +DD +   P  I + +AFENA+ 
Sbjct: 211 LGLSLPGNGSLLATHSDRRELFLEAGRRVMALANRYYRDDDESALPRNIASFKAFENAMA 270

Query: 269 TNAAIGGSTNAVIHLLAIAGRVGIDLSLDDWDRCGRDVPTIVNLMPS-GKYLMEEFFYAG 327
            + A+GGS+N V+HLLA A    +D ++ D DR  R VP +  + PS  KY ME+   AG
Sbjct: 271 LDIAMGGSSNTVLHLLAAAQEAKVDFTMADIDRLSRQVPHLCKVAPSTPKYHMEDVHRAG 330

Query: 328 GLPVVLKRLGEAGLLHKDALTVSGETV------WDEVKDV-------------------- 361
           G+  +L  L  AGLLH D   V+GE +      +D V+                      
Sbjct: 331 GVMGILGELDRAGLLHTDVSHVAGENLKAVLVQYDLVQTQDEAVQQFYAAGPAGIPTTKA 390

Query: 362 -----------VNWNEDVILPAEKALTSSGGIVVLRGNLAPKGAVLKPSAASPHLLVHKG 410
                      V+  E  I   E A +  GG+ VL GN+A  G ++K +          G
Sbjct: 391 FSQSCRWPSLDVDRQEGCIRTREFAFSQEGGLAVLSGNIAADGCIVKTAGVDEANHTFVG 450

Query: 411 RAVVFEDIDDYKAKINDDNLDIDENCIMVMKNCGPKGYPGMAEVGNMGLPPKVLK-KGI- 468
            A V+E  DD  A I     ++    ++V++  GPKG PGM E   M  P   LK KG+ 
Sbjct: 451 HARVYESQDDAVAGILGG--EVVAGDVVVIRYEGPKGGPGMQE---MLYPTSYLKSKGLG 505

Query: 469 LDMVRISDARMSGTAYGTVVLHTSPEAAVGGPLAVVKNGDMIELDVPNRRLHLDISDEEL 528
                I+D R SG   G  + H SPEAA GG +A+V+ GD IE+D+P R + L +SDE L
Sbjct: 506 TSCALITDGRFSGGTSGLSIGHVSPEAAAGGTIALVETGDRIEIDIPARSITLAVSDEVL 565

Query: 529 --------ARRLAEWQP-NHDLPTSGYAFLHQQHVEGADTGADLDFLK 567
                   AR    W+P N +   S     +      AD GA  D  K
Sbjct: 566 ETRRQAMQARGKQAWKPVNRERSVSLALKAYAMLATSADKGAVRDVSK 613


Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 916
Number of extensions: 45
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 579
Length of database: 616
Length adjustment: 37
Effective length of query: 542
Effective length of database: 579
Effective search space:   313818
Effective search space used:   313818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory