Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate 5208627 Shew_1136 pyrroline-5-carboxylate reductase (RefSeq)
Query= curated2:P52053 (272 letters) >FitnessBrowser__PV4:5208627 Length = 272 Score = 276 bits (707), Expect = 3e-79 Identities = 142/272 (52%), Positives = 186/272 (68%) Query: 1 MEHKKIAFIGAGNMVRAIVSGLVANGYPAQNITATAPSEARRLPLEQDFGIRTTSDNIQA 60 M KKI FIGAGNM R+I SGLV GY + I AT PSE + + L+QD GIR + DN+QA Sbjct: 1 MTQKKICFIGAGNMTRSITSGLVKGGYAPELIHATNPSEGKLIALKQDLGIRVSHDNLQA 60 Query: 61 ATEADVVVLSVKPQMMADVCKPLQAIDFTNKLVISIAAGINCSRLDDMLATKLNLVRVMP 120 A EADV+VL+VKPQ+M VC+ + ++ +KL+++IAAG+ R + L+R MP Sbjct: 61 ADEADVIVLAVKPQLMQQVCEAMSGLNLKDKLIVTIAAGVTAERYHAFFKQPIQLIRTMP 120 Query: 121 NTPSQLGLGMSGLFAPIHVTEHDKAFAAELMEAVGKVCWVEQESGINNVIAAAGSAPAYF 180 NTP+Q+GLGM+GL+A V+ D+ +LM+ G+ WVE+E +N VIA AGS+PAYF Sbjct: 121 NTPTQIGLGMTGLYAEQGVSAQDRELCEQLMQTGGETVWVEKEEDLNQVIALAGSSPAYF 180 Query: 181 FLFMEAMQAEAIAQGFDKESARLLVQQAALGAASMVVSNPETELSTLRENVTSKGGTTAE 240 FL MEAM A G D+++AR +VQQAALGAA+MV NP+ + LRENVTSKGGTTA+ Sbjct: 181 FLMMEAMIDSAKQDGVDEQTAREMVQQAALGAAAMVKQNPQLSPAQLRENVTSKGGTTAQ 240 Query: 241 ALRTFNEHQLSDIVAKAMQAAVARAEEMEKLF 272 AL F L +IV AM + RA+EM K F Sbjct: 241 ALAAFERAGLREIVRTAMHDCMDRAQEMAKQF 272 Lambda K H 0.317 0.129 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 272 Length adjustment: 25 Effective length of query: 247 Effective length of database: 247 Effective search space: 61009 Effective search space used: 61009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 5208627 Shew_1136 (pyrroline-5-carboxylate reductase (RefSeq))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00112.hmm # target sequence database: /tmp/gapView.27243.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-78 247.6 4.5 9.3e-78 247.5 4.5 1.0 1 lcl|FitnessBrowser__PV4:5208627 Shew_1136 pyrroline-5-carboxylat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208627 Shew_1136 pyrroline-5-carboxylate reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 247.5 4.5 9.3e-78 9.3e-78 1 263 [] 6 268 .. 6 268 .. 0.98 Alignments for each domain: == domain 1 score: 247.5 bits; conditional E-value: 9.3e-78 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPqdleevlae 78 i +iGaGnm +++ sgl+k g a++ i+ +++se kl al ++lg++v++d+ +a++eadv++lavKPq +++v++ lcl|FitnessBrowser__PV4:5208627 6 ICFIGAGNMTRSITSGLVKGGY-APELIHATNPSEGKLIALKQDLGIRVSHDNLQAADEADVIVLAVKPQLMQQVCEA 82 68****************9755.59****************************************************9 PP TIGR00112 79 lkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevseeqkelveellkavGkvve 156 + + + k+kl+++i+AGvt+e+++ +++ +++R mPNt+ ++g g+t+++a++ vs++++el e+l+++ G++v+ lcl|FitnessBrowser__PV4:5208627 83 MSG-LNLKDKLIVTIAAGVTAERYHAFFKQPIQLIRTMPNTPTQIGLGMTGLYAEQGVSAQDRELCEQLMQTGGETVW 159 999.7779*********************99*********************************************** PP TIGR00112 157 ve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesge.hpalLkdkVtsPgGt 232 ve e++l++v al+GS+PA++fl++ea++d++ + G ++++a+e+++q+ Gaa++++++ + +pa+L+++Vts+gGt lcl|FitnessBrowser__PV4:5208627 160 VEkEEDLNQVIALAGSSPAYFFLMMEAMIDSAKQDGVDEQTAREMVQQAALGAAAMVKQNPQlSPAQLRENVTSKGGT 237 ***********************************************************9889*************** PP TIGR00112 233 TiaglavLeekgvrsavieaveaavkrseeL 263 T+++la++e++g+r+ v a++ +++r++e+ lcl|FitnessBrowser__PV4:5208627 238 TAQALAAFERAGLREIVRTAMHDCMDRAQEM 268 ****************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (272 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.07 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory