Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate 5209222 Shew_1700 phosphate ABC transporter, ATPase subunit (RefSeq)
Query= SwissProt::P54537 (240 letters) >FitnessBrowser__PV4:5209222 Length = 272 Score = 149 bits (377), Expect = 4e-41 Identities = 91/244 (37%), Positives = 142/244 (58%), Gaps = 11/244 (4%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLN----LLEKPN-GG 56 +++ L +G + L ++S I + +V A IGPSG GKST LRC+N L++ N G Sbjct: 26 LEIRNLDLKYGDKQALFDVSMKIPKKKVTAFIGPSGCGKSTLLRCINRMNDLVDNCNIDG 85 Query: 57 TITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEK 116 I + I K + +R N+GMVFQ + FP K++ EN++Y +++ E Sbjct: 86 EILLHGQNIYDKKVDVASLRRNVGMVFQRPNPFP-KSIYENVVYGLRLQGINNRRQLDEA 144 Query: 117 AEDLLRKVGLFEKRND--YPNR--LSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMV 172 AE LR ++++ D + N LSGGQ+QR+ IARA+A+ P+++L DEPTSALDP Sbjct: 145 AERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIARAIAIEPEVLLLDEPTSALDPIST 204 Query: 173 KEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRA 232 + +++ EL + T+VIVTH M A V+D+ FM G +VE + F +PK K+ Sbjct: 205 LTIEELITEL-KAKYTVVIVTHNMQQAARVSDQTAFMYMGELVEYADTNTIFTTPKKKKT 263 Query: 233 QDFL 236 +D++ Sbjct: 264 EDYI 267 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 272 Length adjustment: 24 Effective length of query: 216 Effective length of database: 248 Effective search space: 53568 Effective search space used: 53568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory