Align Arginine N-succinyltransferase (EC 2.3.1.109) (characterized)
to candidate 5208067 Shew_0579 arginine N-succinyltransferase (RefSeq)
Query= reanno::SB2B:6938907 (339 letters) >FitnessBrowser__PV4:5208067 Length = 339 Score = 577 bits (1488), Expect = e-169 Identities = 284/339 (83%), Positives = 311/339 (91%) Query: 1 MLIIRPIRASDFDALYRIAVESGHGFTSLPVNEDLLRRKIARSEASFQKVVETPYDEGYL 60 MLIIRPIR+SDFDALY+IA+ESGHGFTSLPVNE+LLR KIAR EASF K +E P+DEGYL Sbjct: 1 MLIIRPIRSSDFDALYQIAIESGHGFTSLPVNEELLRNKIARVEASFVKEIEKPFDEGYL 60 Query: 61 MVLEDTQTQEVVGTCALEAAVGMEDAFYHYRLGTEVYHSQQINVRNEVETLTLCHDYTGA 120 MVLEDT+T EVVGTC LEAAVGM DAFYHYRLGTEVY+S+QI+VRNEVETLTLCHDYTGA Sbjct: 61 MVLEDTETGEVVGTCGLEAAVGMVDAFYHYRLGTEVYYSEQIDVRNEVETLTLCHDYTGA 120 Query: 121 AELCTLFLRGAYRKDNNGRMLSRSRFLFLAQHANRFGETVIAEMRGVSDENGNSPFYGWL 180 AELCTLFLR YRK+NNGRMLSRSRFLFLAQHA RFG+TVIAEMRG SD GNSPFYGWL Sbjct: 121 AELCTLFLRDTYRKNNNGRMLSRSRFLFLAQHAERFGDTVIAEMRGESDAEGNSPFYGWL 180 Query: 181 QKHFLGIDFVEADYLSGLGRKAFMAEMMPRNPVYVCLLPEEAQKVIGEVHTNTRPALSLL 240 QK+FLGIDFV+ADYLSGLG+KAFMAEMMP+N VYVCLLPEEAQKVIGEVHTNTRPAL+LL Sbjct: 181 QKNFLGIDFVQADYLSGLGQKAFMAEMMPKNSVYVCLLPEEAQKVIGEVHTNTRPALNLL 240 Query: 241 RAEGFRCRGYVDIFDGGPTVECNLQDIRGVRESRLLTVRIGEMPASDDSFILSNTQLVDY 300 +AEGFRCRGYVDIFDGGPTVECNL DIR VRESRLLTV++GEMP S SFI+SNT L Y Sbjct: 241 QAEGFRCRGYVDIFDGGPTVECNLNDIRSVRESRLLTVKVGEMPVSSSSFIISNTLLAGY 300 Query: 301 RATSVELMVSSDSDEVILSPELAAGLLVSDGEQVRVLAI 339 RATS LMVS ++DEVILSPELA LLV++GEQ+RVLA+ Sbjct: 301 RATSANLMVSDETDEVILSPELAGALLVAEGEQIRVLAM 339 Lambda K H 0.321 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate 5208067 Shew_0579 (arginine N-succinyltransferase (RefSeq))
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.23788.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-140 451.1 0.0 1.1e-139 450.9 0.0 1.0 1 lcl|FitnessBrowser__PV4:5208067 Shew_0579 arginine N-succinyltra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208067 Shew_0579 arginine N-succinyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.9 0.0 1.1e-139 1.1e-139 1 335 [. 3 338 .. 3 339 .] 0.97 Alignments for each domain: == domain 1 score: 450.9 bits; conditional E-value: 1.1e-139 TIGR03244 1 ivrpvktsdldallelakeaGvGltslpaneellekrieraeksfage.leraeegylfvledtetgkvvGvsaieaa 77 i+rp+++sd+dal+++a e+G+G+tslp+neell+++i+r e sf +e ++ +egyl+vledtetg+vvG++++eaa lcl|FitnessBrowser__PV4:5208067 3 IIRPIRSSDFDALYQIAIESGHGFTSLPVNEELLRNKIARVEASFVKEiEKPFDEGYLMVLEDTETGEVVGTCGLEAA 80 79**********************************************44567************************* PP TIGR03244 78 vGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfldeeyrkelnGkllskarflflaefkerfsk 155 vG+ ++fy+yr+g+ v s+++++ +++etl+l++d+tga+elCtlfl+++yrk++nG++ls++rflfla++ erf++ lcl|FitnessBrowser__PV4:5208067 81 VGMVDAFYHYRLGTEVYYSEQIDVRNEVETLTLCHDYTGAAELCTLFLRDTYRKNNNGRMLSRSRFLFLAQHAERFGD 158 ****************************************************************************** PP TIGR03244 156 kiiaemrGvsdeeGrsPfWealgkkffsldfskadylsgiGkkafiaelmPkfPiyvdllskeaqdvigkvhektkPa 233 ++iaemrG sd eG+sPf+ +l+k+f +df +adylsg+G+kaf+ae+mPk +yv+ll++eaq+vig+vh++t+Pa lcl|FitnessBrowser__PV4:5208067 159 TVIAEMRGESDAEGNSPFYGWLQKNFLGIDFVQADYLSGLGQKAFMAEMMPKNSVYVCLLPEEAQKVIGEVHTNTRPA 236 ****************************************************************************** PP TIGR03244 234 lalleseGlryqgyvdifdaGptleaevakiravresklvevavaesaaedeaepylvanekledfrvvlvess..ld 309 l+ll++eG+r +gyvdifd+Gpt+e+++++ir+vres+l++v+v+e + ++++++n+ l+ +r++ +++ + lcl|FitnessBrowser__PV4:5208067 237 LNLLQAEGFRCRGYVDIFDGGPTVECNLNDIRSVRESRLLTVKVGEMPVSS--SSFIISNTLLAGYRATSANLMvsDE 312 *********************************************988877..89**************998764478 PP TIGR03244 310 aeelvlsaeeakalkveeGdkvrvva 335 ++e++ls+e a al v eG+++rv+a lcl|FitnessBrowser__PV4:5208067 313 TDEVILSPELAGALLVAEGEQIRVLA 338 99**********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.16 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory