Align Arginine N-succinyltransferase (EC 2.3.1.109) (characterized)
to candidate 5208067 Shew_0579 arginine N-succinyltransferase (RefSeq)
Query= reanno::SB2B:6938907 (339 letters) >lcl|FitnessBrowser__PV4:5208067 Shew_0579 arginine N-succinyltransferase (RefSeq) Length = 339 Score = 577 bits (1488), Expect = e-169 Identities = 284/339 (83%), Positives = 311/339 (91%) Query: 1 MLIIRPIRASDFDALYRIAVESGHGFTSLPVNEDLLRRKIARSEASFQKVVETPYDEGYL 60 MLIIRPIR+SDFDALY+IA+ESGHGFTSLPVNE+LLR KIAR EASF K +E P+DEGYL Sbjct: 1 MLIIRPIRSSDFDALYQIAIESGHGFTSLPVNEELLRNKIARVEASFVKEIEKPFDEGYL 60 Query: 61 MVLEDTQTQEVVGTCALEAAVGMEDAFYHYRLGTEVYHSQQINVRNEVETLTLCHDYTGA 120 MVLEDT+T EVVGTC LEAAVGM DAFYHYRLGTEVY+S+QI+VRNEVETLTLCHDYTGA Sbjct: 61 MVLEDTETGEVVGTCGLEAAVGMVDAFYHYRLGTEVYYSEQIDVRNEVETLTLCHDYTGA 120 Query: 121 AELCTLFLRGAYRKDNNGRMLSRSRFLFLAQHANRFGETVIAEMRGVSDENGNSPFYGWL 180 AELCTLFLR YRK+NNGRMLSRSRFLFLAQHA RFG+TVIAEMRG SD GNSPFYGWL Sbjct: 121 AELCTLFLRDTYRKNNNGRMLSRSRFLFLAQHAERFGDTVIAEMRGESDAEGNSPFYGWL 180 Query: 181 QKHFLGIDFVEADYLSGLGRKAFMAEMMPRNPVYVCLLPEEAQKVIGEVHTNTRPALSLL 240 QK+FLGIDFV+ADYLSGLG+KAFMAEMMP+N VYVCLLPEEAQKVIGEVHTNTRPAL+LL Sbjct: 181 QKNFLGIDFVQADYLSGLGQKAFMAEMMPKNSVYVCLLPEEAQKVIGEVHTNTRPALNLL 240 Query: 241 RAEGFRCRGYVDIFDGGPTVECNLQDIRGVRESRLLTVRIGEMPASDDSFILSNTQLVDY 300 +AEGFRCRGYVDIFDGGPTVECNL DIR VRESRLLTV++GEMP S SFI+SNT L Y Sbjct: 241 QAEGFRCRGYVDIFDGGPTVECNLNDIRSVRESRLLTVKVGEMPVSSSSFIISNTLLAGY 300 Query: 301 RATSVELMVSSDSDEVILSPELAAGLLVSDGEQVRVLAI 339 RATS LMVS ++DEVILSPELA LLV++GEQ+RVLA+ Sbjct: 301 RATSANLMVSDETDEVILSPELAGALLVAEGEQIRVLAM 339 Lambda K H 0.321 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate 5208067 Shew_0579 (arginine N-succinyltransferase (RefSeq))
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.14754.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-140 451.1 0.0 1.1e-139 450.9 0.0 1.0 1 lcl|FitnessBrowser__PV4:5208067 Shew_0579 arginine N-succinyltra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208067 Shew_0579 arginine N-succinyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.9 0.0 1.1e-139 1.1e-139 1 335 [. 3 338 .. 3 339 .] 0.97 Alignments for each domain: == domain 1 score: 450.9 bits; conditional E-value: 1.1e-139 TIGR03244 1 ivrpvktsdldallelakeaGvGltslpaneellekrieraeksfage.leraeegylfvledtetgkvvGvsaieaa 77 i+rp+++sd+dal+++a e+G+G+tslp+neell+++i+r e sf +e ++ +egyl+vledtetg+vvG++++eaa lcl|FitnessBrowser__PV4:5208067 3 IIRPIRSSDFDALYQIAIESGHGFTSLPVNEELLRNKIARVEASFVKEiEKPFDEGYLMVLEDTETGEVVGTCGLEAA 80 79**********************************************44567************************* PP TIGR03244 78 vGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfldeeyrkelnGkllskarflflaefkerfsk 155 vG+ ++fy+yr+g+ v s+++++ +++etl+l++d+tga+elCtlfl+++yrk++nG++ls++rflfla++ erf++ lcl|FitnessBrowser__PV4:5208067 81 VGMVDAFYHYRLGTEVYYSEQIDVRNEVETLTLCHDYTGAAELCTLFLRDTYRKNNNGRMLSRSRFLFLAQHAERFGD 158 ****************************************************************************** PP TIGR03244 156 kiiaemrGvsdeeGrsPfWealgkkffsldfskadylsgiGkkafiaelmPkfPiyvdllskeaqdvigkvhektkPa 233 ++iaemrG sd eG+sPf+ +l+k+f +df +adylsg+G+kaf+ae+mPk +yv+ll++eaq+vig+vh++t+Pa lcl|FitnessBrowser__PV4:5208067 159 TVIAEMRGESDAEGNSPFYGWLQKNFLGIDFVQADYLSGLGQKAFMAEMMPKNSVYVCLLPEEAQKVIGEVHTNTRPA 236 ****************************************************************************** PP TIGR03244 234 lalleseGlryqgyvdifdaGptleaevakiravresklvevavaesaaedeaepylvanekledfrvvlvess..ld 309 l+ll++eG+r +gyvdifd+Gpt+e+++++ir+vres+l++v+v+e + ++++++n+ l+ +r++ +++ + lcl|FitnessBrowser__PV4:5208067 237 LNLLQAEGFRCRGYVDIFDGGPTVECNLNDIRSVRESRLLTVKVGEMPVSS--SSFIISNTLLAGYRATSANLMvsDE 312 *********************************************988877..89**************998764478 PP TIGR03244 310 aeelvlsaeeakalkveeGdkvrvva 335 ++e++ls+e a al v eG+++rv+a lcl|FitnessBrowser__PV4:5208067 313 TDEVILSPELAGALLVAEGEQIRVLA 338 99**********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory