Align Succinylglutamate desuccinylase; EC 3.5.1.96 (uncharacterized)
to candidate 5209453 Shew_1924 succinylglutamate desuccinylase (RefSeq)
Query= curated2:A4Y6M4 (344 letters) >FitnessBrowser__PV4:5209453 Length = 355 Score = 442 bits (1136), Expect = e-129 Identities = 229/352 (65%), Positives = 263/352 (74%), Gaps = 17/352 (4%) Query: 1 MLQALLDSKDFLALTLAHPEQFDGEFSFNLGDHTQVEVWDTGVIVFEPI---------QN 51 M L+ SKDFL LTL +P + F F LG HTQV VWDTGVI FEP+ + Sbjct: 1 MRDTLMLSKDFLQLTLDNPVGLEA-FEFTLGQHTQVSVWDTGVIQFEPLVTYEANQESEQ 59 Query: 52 EGKD-----IVLSCGVHGNETAPIELCNSLIKQLLQQKIIAKQRTLFLIGNPLAINNGTR 106 +GK+ IVLS VHGNETAPIELC+ LI LL + +IA+ R LFLIGNP AI NGTR Sbjct: 60 DGKEEALKSIVLSSAVHGNETAPIELCDQLITALLSETLIARHRLLFLIGNPPAILNGTR 119 Query: 107 IIDENMNRLFSGEHSNPPGLVNPERVRAKKLEAYVDRFFTAAADGRQRIHYDLHTAMRAS 166 ++EN+NRLFSG H+ G N ERVRAKKLE YVDRFF AA R HYDLHTA+RAS Sbjct: 120 FVEENLNRLFSGAHAK--GESNAERVRAKKLEQYVDRFFNAAPKDGSRYHYDLHTAIRAS 177 Query: 167 KHEKFAIYPYRPGRAFSGEQIMFLAASGVDTVLFHHEPTTTFSYFSSERYGADAFTIELG 226 KHEKFAIYPY G +SGEQIMFLAA G++TVLFHHEPTTTFSYFS+ Y A AFTIELG Sbjct: 178 KHEKFAIYPYPHGAPYSGEQIMFLAACGINTVLFHHEPTTTFSYFSAHGYQAHAFTIELG 237 Query: 227 KVYPMGQNDMTRFIATHEMFMRLITAKPLELDAFDADKVNLYQVCRVINKHFDDFEFTFA 286 KV PMGQNDMTRFIA EM RL++ + LEL FD +VNLYQV R INK FDDF FTFA Sbjct: 238 KVMPMGQNDMTRFIAVKEMLTRLVSGRDLELGEFDPSQVNLYQVHRSINKQFDDFSFTFA 297 Query: 287 TDVENFRSFPKGFVLAREGGQEIKVEHEFESVVFPNAKVPIGNRTVICLIPA 338 DVENF +FP+G++LA++GG EIKVE E ES+VFPNA VP+G RTV+CL+PA Sbjct: 298 DDVENFTAFPRGYILAKDGGTEIKVEAESESIVFPNANVPVGQRTVLCLVPA 349 Lambda K H 0.323 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 355 Length adjustment: 29 Effective length of query: 315 Effective length of database: 326 Effective search space: 102690 Effective search space used: 102690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
Align candidate 5209453 Shew_1924 (succinylglutamate desuccinylase (RefSeq))
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03242.hmm # target sequence database: /tmp/gapView.31723.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03242 [M=319] Accession: TIGR03242 Description: arg_catab_astE: succinylglutamate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-113 363.8 0.1 4.8e-113 363.6 0.1 1.0 1 lcl|FitnessBrowser__PV4:5209453 Shew_1924 succinylglutamate desu Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209453 Shew_1924 succinylglutamate desuccinylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 363.6 0.1 4.8e-113 4.8e-113 1 318 [. 10 346 .. 10 347 .. 0.95 Alignments for each domain: == domain 1 score: 363.6 bits; conditional E-value: 4.8e-113 TIGR03242 1 dflaltlekkepevtqge..aknvklrwldeGvlelePe..............aeaekslvisaGihGnetaPielle 62 dfl+ltl++ + + + ++ d+Gv++ eP +ea ks+v+s+ +hGnetaPiel + lcl|FitnessBrowser__PV4:5209453 10 DFLQLTLDNPVGLEAFEFtlGQHTQVSVWDTGVIQFEPLvtyeanqeseqdgkEEALKSIVLSSAVHGNETAPIELCD 87 79999999988844444413455566689*********************9999999********************* PP TIGR03242 63 qllsdiaagklqlkvrlLlilGnpaalrkgkRyleedlnRlfgGryqeleeskeklRaeeLeqvveaffeagkasear 140 ql++++++++l ++rlL+++Gnp+a+ +g R++ee+lnRlf+G +++ e+ e+ Ra++Leq+v +ff+a+ + +r lcl|FitnessBrowser__PV4:5209453 88 QLITALLSETLIARHRLLFLIGNPPAILNGTRFVEENLNRLFSGAHAKGESNAERVRAKKLEQYVDRFFNAAPKDGSR 165 ***************************************************************************9** PP TIGR03242 141 yhyDlhtaiRasklekfallPyq.ekpfdkellewlaaadldavllhkekggtfshfssekleaeactlelGkarPfG 217 yhyDlhtaiRask+ekfa++Py + p++ e++ +laa+++++vl+h+e+++tfs+fs++ ++a+a+t+elGk++P G lcl|FitnessBrowser__PV4:5209453 166 YHYDLHTAIRASKHEKFAIYPYPhGAPYSGEQIMFLAACGINTVLFHHEPTTTFSYFSAHGYQAHAFTIELGKVMPMG 243 **********************98****************************************************** PP TIGR03242 218 endlsqfqaitealralisdeaiparkke..elklfevvesilkksdsfelhvaedasnftefakGtllaedkderyr 293 +nd+++f a++e l++l+s++ + +++ +++l++v +si k+ d+f + a+d++nft f++G++la+d ++ + lcl|FitnessBrowser__PV4:5209453 244 QNDMTRFIAVKEMLTRLVSGRDLELGEFDpsQVNLYQVHRSINKQFDDFSFTFADDVENFTAFPRGYILAKDGGTEIK 321 **********************99999987799********************************************* PP TIGR03242 294 veeeeerilfPnakvanGlRaglll 318 ve e+e+i+fPna+v G+R +l l lcl|FitnessBrowser__PV4:5209453 322 VEAESESIVFPNANVPVGQRTVLCL 346 **********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (319 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.50 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory