Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 5210164 Shew_2608 inner-membrane translocator (RefSeq)
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__PV4:5210164 Length = 357 Score = 129 bits (324), Expect = 2e-34 Identities = 96/332 (28%), Positives = 155/332 (46%), Gaps = 29/332 (8%) Query: 113 IALLLYPMVVVAIKGPQGSLTYVDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAV 172 I L+ ++ +A P Y IQI + A GLNI+VG G + LG+ AF+ Sbjct: 28 IRLVTCLVIALACAAPLVLDGYFLTLFIQISYLGIAALGLNILVGFTGQISLGHGAFFGF 87 Query: 173 GAYSYALLSSYFGLSFWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLV 232 GA++ A L++ F + +PL+G G++ G P R++G YLAI TLA II+ Sbjct: 88 GAFASAWLNTSFNIPVVFCIPLAGFLTMGVGMMFGMPAARIKGLYLAIATLAAQFIIQDF 147 Query: 233 LINWTDVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYKIFLFYLILALCM 292 + G+ G + P +LFG FD FY I + Sbjct: 148 FGRAEWFSGGSSGAMAAP-VSLFGFDFDTDMS-------------------FYFIALFAL 187 Query: 293 LTAYV-TIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAA 351 + Y+ L R GRA+ A+R+ ++ +G+ +L +F + +AG G+ +A Sbjct: 188 VFMYIWGCNLMRSRDGRAFVAVRDHYLSAEIMGVKLNKYRLLSFGISSFYAGIGGALYAH 247 Query: 352 RQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMV-------GGTELLREMSFL 404 G+VS E F L S LA+V++GG+GS+ G + + MV G L++ + Sbjct: 248 YLGYVSSEGFTILMSIQFLAMVIIGGLGSIKGTLMGVVFMVLLPEVLEGMVGLMKYTDYG 307 Query: 405 KLIFGPDFTPELYRMLIFGLAMVVVMLFKPRG 436 L D + M I GL +++ ++F+P G Sbjct: 308 NLPMVTDGLAYIKEMAI-GLVIILFLIFEPEG 338 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 35 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 357 Length adjustment: 31 Effective length of query: 432 Effective length of database: 326 Effective search space: 140832 Effective search space used: 140832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory