GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Shewanella loihica PV-4

Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate 5208454 Shew_0966 beta alanine--pyruvate transaminase (RefSeq)

Query= reanno::pseudo3_N2E3:AO353_08585
         (454 letters)



>lcl|FitnessBrowser__PV4:5208454 Shew_0966 beta alanine--pyruvate
           transaminase (RefSeq)
          Length = 446

 Score =  290 bits (741), Expect = 8e-83
 Identities = 165/433 (38%), Positives = 248/433 (57%), Gaps = 24/433 (5%)

Query: 17  EHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAA 76
           EH+  PF+  +Q K+  PR++  A+G+Y  D  G  +LDG AGLWC   G+GR  +++A 
Sbjct: 16  EHYWMPFTANRQFKQS-PRLLAQAEGMYYKDVNGRPVLDGTAGLWCCNAGHGRKAISEAV 74

Query: 77  SKQMRELPYYNLFFQTAHPPVLELAKAISDIAPEGMNHVFFTGSGSEGNDTMLRMVRHYW 136
           SKQ+ E+ Y   F Q  HP   ELA+ ++ IAP+G+N VFFT SGSE  DT L++  +Y 
Sbjct: 75  SKQIHEMDYAPSF-QMGHPLAFELAERLAAIAPKGINKVFFTNSGSESVDTALKIALNYH 133

Query: 137 AIKGQPNKKVIISRINGYHGSTVAGASLGGM-----TYMHEQGDLPIPGIVHIPQPYWFG 191
             +G+  +   I R  GYHG    G S+GG+     T+  +     + G+ H+P      
Sbjct: 134 RARGEATRTRFIGRELGYHGVGFGGISVGGIGGNRRTFSQQL----LQGVDHLPHTLDIQ 189

Query: 192 EGGDMTP-EEFGIWAANQLEEKILELGVDTVGAFIAEPIQGAGGVIIPPDSYWPRIKEIL 250
           +        E G   A  LE+ +   G + + A I EP+ G+ GVI+PP  Y  R++EI 
Sbjct: 190 QNAFCKGLPETGAEKAEVLEQLVTLHGAENIAAVIVEPMSGSAGVILPPQGYLKRLREIT 249

Query: 251 AKYDILFVADEVICGFGRTGEWFGSDFYGLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEV 310
            KY IL + DEVI GFGR G+ F S  +G+ PDM+T AK L +G IPMG +++ D + + 
Sbjct: 250 RKYGILLIFDEVITGFGRVGDAFASQRWGVTPDMITTAKALNNGTIPMGAVLIDDAIYDA 309

Query: 311 ---LNEGG-DFNHGFTYSGHPVAAAVALENIRILREEKIIEHVRAETAPYLQKRLRELND 366
                EG  +  HG+TYSGHPVAAA A+  + I +EE++ E  ++    Y +K +  L  
Sbjct: 310 SMDAPEGAIELYHGYTYSGHPVAAAAAIATLDIYQEEQLFERTKS-LEGYFEKAVHSLKG 368

Query: 367 HPLVGEVRGVGLLGAIEL-VQDKATRARYVGKGVGMICRQFCFDNGLIMRAVGDTMIIAP 425
            P + ++R  GL+  I+    DK    R    G G+   + CF NG ++RA  DT+ ++P
Sbjct: 369 LPNLIDIRNTGLVAGIQFSPSDKGIGKR----GFGIF--ETCFKNGTLVRATADTIALSP 422

Query: 426 PLVITKAEIDELV 438
           PL++ +A+ID++V
Sbjct: 423 PLIVDEAQIDQMV 435


Lambda     K      H
   0.320    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 521
Number of extensions: 22
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 454
Length of database: 446
Length adjustment: 33
Effective length of query: 421
Effective length of database: 413
Effective search space:   173873
Effective search space used:   173873
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory