Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate 5208066 Shew_0578 bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein (RefSeq)
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__PV4:5208066 Length = 405 Score = 191 bits (486), Expect = 3e-53 Identities = 139/389 (35%), Positives = 206/389 (52%), Gaps = 35/389 (8%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELL--DPLRAMLAKTLAA 135 D +G EF+D GG + +GH +P +V A++ Q ++ H ++ +P A+ K + A Sbjct: 37 DQEGNEFVDFAGGIAVNCLGHCHPALVGALKEQ-GEKIWHLANVMTNEPALALATKLVEA 95 Query: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATA 192 K+ +F NSG E+ EAALKLA+ Y + K IA AFHG++ +S Sbjct: 96 TFAEKV---YFANSGAEANEAALKLARRYALDKFGAEKDQIIAFDKAFHGRTFFTVSVGG 152 Query: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252 ++ + F P H+PF +I A+ ++ D A++LEP+QGEGG+I P Sbjct: 153 QAAYSDGFGPKPQSITHLPFNDIAALEAEVS------DKTCAIMLEPLQGEGGIIDADPE 206 Query: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312 +L AVR L D+ AL+I DEVQTG+GR G+++A V PDIL AKALGGG PI A Sbjct: 207 FLRAVRALADKHNALVIFDEVQTGVGRLGELYAYMRTEVTPDILTTAKALGGG-FPIAAM 265 Query: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372 + T E+ S L H +T+GGNPLACA A ++V+ + +++ +L DG Q Sbjct: 266 LTTTEIASHL--KIGTHGSTYGGNPLACAIGNAVLDVVNTPEVLDGVKRREQLLRDGLNQ 323 Query: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGT-------LNNAKTI 425 + +Y + E RG+G+L+ V NE Y S+ F LVAGT + I Sbjct: 324 INEKY-HVFTEVRGQGLLLGA--VLNE-QYQGRSKDF----LVAGTSEGLMCLIAGPNVI 375 Query: 426 RIEPPLTLTIEQCELVIKAARKALAAMRV 454 R P +L I + ++ AR A +V Sbjct: 376 RFTP--SLVIPEADIAEGLARFERAVAKV 402 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 405 Length adjustment: 32 Effective length of query: 427 Effective length of database: 373 Effective search space: 159271 Effective search space used: 159271 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory