GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuB in Shewanella loihica PV-4

Align Gamma-glutamylputrescine oxidoreductase; Gamma-Glu-Put oxidase; Gamma-glutamylputrescine oxidase; EC 1.4.3.- (characterized)
to candidate 5209538 Shew_2005 FAD dependent oxidoreductase (RefSeq)

Query= SwissProt::P37906
         (426 letters)



>lcl|FitnessBrowser__PV4:5209538 Shew_2005 FAD dependent
           oxidoreductase (RefSeq)
          Length = 443

 Score =  163 bits (413), Expect = 9e-45
 Identities = 134/430 (31%), Positives = 211/430 (49%), Gaps = 20/430 (4%)

Query: 7   SYYAASANKYAPFDTLNESITCDVCVVGGGYTGLSSALHLA-EAGFDVVVLEASRIGFGA 65
           SY+A + ++ A    L+  +  DV +VGGG+TGL +A +LA E   +  VLEA++IGFGA
Sbjct: 19  SYWATTVSRPARLPALSGRMQTDVAIVGGGFTGLLTAYYLASEFNIEARVLEANQIGFGA 78

Query: 66  SGRNGGQLVNSYSR-DIDVIEKSYGMDTARMLGSMMFEGGEIIRERIKRYQIDCDYRPGG 124
           SGRN G ++    R     + K +GM+T + +          + + I++++I CD +P G
Sbjct: 79  SGRNAGFVLKGSGRMGYSQMAKKWGMETTKGIYGEFTSAVRRVEQLIEQHEIACDAQPKG 138

Query: 125 -LFVAMNDKQLATLEEQKENWERYGNKQLELLDANAIRREVASDRYT-GALLDHSGGHIH 182
            L +A N K  +TL+   +    +     + L  + ++     +    GAL  + G  ++
Sbjct: 139 YLKIAHNAKAYSTLKGAADFIAEHLGDDAQFLTPSELKESYMDNHQAYGALRLNDGFGVN 198

Query: 183 PLNLAIGEADAIRLNGGRVYELSAVTQ-IQHTTPAVVRTAKGQVTAKYVIVAGNAYLGDK 241
           PL L +G    ++  G  ++E S V + ++      + T KG++ AK V+ AGNAY   +
Sbjct: 199 PLKLCLGYKRVVQSLGVHLHEESCVREWLKEGPHHRLITDKGELIAKQVVSAGNAYTPKR 258

Query: 242 VEPELAKRSMPCGTQVITTERLSE-DLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGG 300
               +  R +P  + +I T  L++  L  + +  +  V D   L  YYRL +DNRLL+GG
Sbjct: 259 FNQAVDNRYLPILSNIIVTAPLTDAQLEATGLKTHQVVMDTRRLKYYYRLLSDNRLLFGG 318

Query: 301 -GVVYG--ARDPDDVERLVVPKLLKTFPQLKGVKIDYRWTGNFLLTLSRMPQFGRLDTNI 357
            G + G  A DP   ERL    +   FP L  V +D+ WTG     L  MP       N+
Sbjct: 319 RGAISGADAGDPRYGERL-KSAMADCFPALAEVTVDHNWTGWIAAALDDMPHVFS-QGNM 376

Query: 358 YYMQGYSGHGVTCTHLAGRLIAELLRGDAERFDAFANLPHYPFPGGRTLRVPFTAMG-AA 416
            Y  GY G GV  +  A   +A+ + G     +    LP Y  P  +        +G +A
Sbjct: 377 GYSLGYCGSGVAFSAQAAYRLAQHIAG-----ERLPELPLYQSPLPKFHFARLRRLGQSA 431

Query: 417 YYS---LRDR 423
           YY    LRDR
Sbjct: 432 YYQYAWLRDR 441


Lambda     K      H
   0.320    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 514
Number of extensions: 35
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 426
Length of database: 443
Length adjustment: 32
Effective length of query: 394
Effective length of database: 411
Effective search space:   161934
Effective search space used:   161934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory