Align arginase (EC 3.5.3.1) (characterized)
to candidate 5209143 Shew_1621 agmatinase (RefSeq)
Query= metacyc::MONOMER-14988 (338 letters) >FitnessBrowser__PV4:5209143 Length = 307 Score = 102 bits (255), Expect = 1e-26 Identities = 89/282 (31%), Positives = 132/282 (46%), Gaps = 25/282 (8%) Query: 59 ASTSLLGIPLGHNSSFLQGPAFAPPLIREAIWCGSTNSTTEEGKI-----LDDQRVLTDV 113 A ++G+P ++ G P IR+A S N EE + L D + D Sbjct: 33 ADVVVIGLPFDMATTGRSGGRMGPGAIRQA----SVNLAWEECRWPWDFKLSDHLKMVDA 88 Query: 114 GDLPVQELRDTGIDDDRLMSTVSESVKLVMDENPLRPLVLGGDHSISYPVVRAVSEKLGG 173 GDL + D G D V + V+D + GGDH ++ P++RA +K G Sbjct: 89 GDL----VFDCG-DAADFTQRVEDFATAVLDSGKAL-MSFGGDHFVTLPLLRAHYKK-HG 141 Query: 174 PVDILHLDAHPDIYDAFEGNKYSHASSFARIMEGGY--ARRLLQVGIRSINLEGREQGKR 231 + +LH DAH D Y +G+KY H + F G A +QVGIR+ E + Sbjct: 142 KMALLHFDAHTDTYS--QGSKYDHGTMFFHAPNEGIIDASHSVQVGIRT---EYDKPSHL 196 Query: 232 FGVEQYEMRTFSRDRQFLENLKLGEGVKGVYISVDVDCLDPAFAPGVSHFESGGLSFRDV 291 F V + + +K G +Y++ D+DCLDPAFAPG GGL+ Sbjct: 197 FKVIDAAAANEMTADEIVAQIKDRVGDMPLYVTFDIDCLDPAFAPGTGTPVCGGLTSDKA 256 Query: 292 LNILHNLQG-DIVGADVVEYNPQRDTADGMTAMVAAKLVREL 332 + I+ L+G ++VG DVVE P D+A+ +TA+ A L E+ Sbjct: 257 MKIIRGLRGMNVVGMDVVEVAPAYDSAE-ITALAGATLGLEM 297 Lambda K H 0.317 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 307 Length adjustment: 28 Effective length of query: 310 Effective length of database: 279 Effective search space: 86490 Effective search space used: 86490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory