GapMind for catabolism of small carbon sources

 

Aligments for a candidate for agcS in Shewanella loihica PV-4

Align Probable Glycine/alanine/asparagine/glutamine uptake porter, AgcS (characterized)
to candidate 5207908 Shew_0424 amino acid carrier protein (RefSeq)

Query= TCDB::W0WFC6
         (449 letters)



>lcl|FitnessBrowser__PV4:5207908 Shew_0424 amino acid carrier
           protein (RefSeq)
          Length = 457

 Score =  608 bits (1567), Expect = e-178
 Identities = 296/450 (65%), Positives = 357/450 (79%), Gaps = 3/450 (0%)

Query: 1   MESLQKWVVDLNGVVWGPLMLVLILGTGLYLMLGLKFMPLVRLGVGFRLLWQGR--SKDD 58
           ME + ++V  +NG VWG  MLV+ILG GL+L  GL+ MP+++LG GF+LLW GR   KD 
Sbjct: 1   MEGITEFVSTINGFVWGTPMLVMILGVGLFLSFGLRLMPILKLGTGFKLLWSGRIPDKDK 60

Query: 59  ESSGEISPFQALMTCLAATVGTGNIAGVATAIFLGGPGALFWMWCTALVGMATKFSEVVL 118
           +  GEISPF ALMT L+AT+GTGNIAGVATAIF+GGPGALFWMWCTALVGMATKFSE VL
Sbjct: 61  QMKGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMWCTALVGMATKFSEAVL 120

Query: 119 AVHYREKDERNEHVGGPMYAIKNGLGKRWAWLGAAFALFGGLAGFGIGNMVQVNSMADAL 178
           AV YRE D+   H+GGPMY IKNGLG +WAWLG AFALFG  AGFGIGN VQ NS+ADAL
Sbjct: 121 AVKYREVDDNGNHIGGPMYYIKNGLGSKWAWLGTAFALFGSFAGFGIGNTVQANSVADAL 180

Query: 179 EVSFGVPDWVTGVATMLVTGLVILGGIRRIGKVAEALVPFMCVGYIVASVIVLVVHAEAI 238
             +FGVP WVTG+  M++ G V++GGI+RI  VA  LVP M V YI A + V+VV+A AI
Sbjct: 181 NSNFGVPTWVTGLVLMVLVGAVLMGGIKRIADVAGKLVPLMTVFYIAAGLSVIVVNAAAI 240

Query: 239 PGAFQLIFTHAFTPIAATGGFAGAAVMAAIRFGVARGIFSNEAGLGTAGIAQAAGTTHSA 298
           P A  LI   AF P+AA GGFAGAAV AA+RFGVARG+FSNEAGLG+A IA AA  T++ 
Sbjct: 241 PDAIALIVHSAFNPVAAQGGFAGAAVWAAVRFGVARGVFSNEAGLGSAPIAHAAAQTNNP 300

Query: 299 VRSGLIGMLGTFIDTLIICSLTGLAIITSGVWTSGASGAALSSAAFEAAMPGVGHYILSL 358
           V  GL+ MLGTFIDTL++C++TGLAI+ SG WTSG +GAAL+S AF  A+P +G+YI+++
Sbjct: 301 VAQGLVAMLGTFIDTLVVCTITGLAIVVSGAWTSGENGAALTSYAFSHALP-MGNYIVAI 359

Query: 359 ALVVFAYTTILGWSYYGERCWEYLAGTRAILPFRIVWTLAIPFGAMTQLDFAWLVADTLN 418
           AL +FA+TTILGWS Y E+C +YL G RA+ PFR +W + +P GA++ LDF WL+ADTLN
Sbjct: 360 ALSIFAFTTILGWSVYSEKCVQYLFGVRAVKPFRAIWVIVVPLGAVSSLDFIWLLADTLN 419

Query: 419 ALMAIPNLIALLLLSPVVFRLTREYFAKAR 448
           A+MAIPNLIAL LLSPVVF LTREYF K R
Sbjct: 420 AMMAIPNLIALSLLSPVVFGLTREYFIKKR 449


Lambda     K      H
   0.326    0.140    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 698
Number of extensions: 41
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 449
Length of database: 457
Length adjustment: 33
Effective length of query: 416
Effective length of database: 424
Effective search space:   176384
Effective search space used:   176384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory