Align PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate 5210215 Shew_2658 ABC transporter-related protein (RefSeq)
Query= TCDB::Q88NY5 (256 letters) >FitnessBrowser__PV4:5210215 Length = 227 Score = 142 bits (357), Expect = 8e-39 Identities = 89/224 (39%), Positives = 129/224 (57%), Gaps = 10/224 (4%) Query: 14 ISIKNVNKWYG---DFQVLTDCSTE--VKKGEVVVVCGPSGSGKSTLIKCVNALEPFQKG 68 I+I+ + K Y DF V S + + +GE V + GPSGSGK+TL+ + ++ G Sbjct: 3 IAIQALTKIYNPESDFPVAAVKSLDLTIAQGEFVAIMGPSGSGKTTLLNMIGGIDSPSSG 62 Query: 69 DIVVDGTSIA--DPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQRKVLGRSEAEAT 126 + +DG I + + R VG +FQ + L P LT EN+ + + G SEAE Sbjct: 63 AVFIDGEDITHLSEQALIAFRRDHVGFIFQDYSLLPVLTALENVEFVMQ-LQGHSEAECR 121 Query: 127 KKGLALLDRVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVSE 186 + +ALL +VGL+A K P +LSGGQQQRVA+ARALA P ++ DEPT+ LD + +E Sbjct: 122 DRAMALLAQVGLAAQQDKIPAKLSGGQQQRVAVARALAPRPRFVMADEPTANLDAKSTAE 181 Query: 187 VLDVMVQL-AQEGMTMMCVTHEMGFARKVANRVIFMDKGSIIED 229 +LD+M L QEG T + TH+ + A RVI + G ++ED Sbjct: 182 LLDIMQSLNEQEGTTFIFSTHDPRVIAR-AKRVIVFEDGRLVED 224 Lambda K H 0.319 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 227 Length adjustment: 23 Effective length of query: 233 Effective length of database: 204 Effective search space: 47532 Effective search space used: 47532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory